(data stored in ACNUC7421 zone)

EMBL: BA000007.PE295

BA000007.PE295       Location/Qualifiers
FT   CDS             325544..325822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0307"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33730"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33730"
FT                   /db_xref="GOA:Q8X6K0"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6K0"
FT                   /protein_id="BAB33730.1"
FT                   /translation="MSLYIKLILSIVREISVNTICSLIVVVALSLLSFSSVAKTITAVG
FT                   STINSTEKEISLQAEKQGKSYKILGAFFKNRVYMIAKLTPVSKNDAS"
     MSLYIKLILS IVREISVNTI CSLIVVVALS LLSFSSVAKT ITAVGSTINS TEKEISLQAE        60
     KQGKSYKILG AFFKNRVYMI AKLTPVSKND AS                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page