(data stored in ACNUC7421 zone)

EMBL: BA000007.PE297

BA000007.PE297       Location/Qualifiers
FT   CDS             327673..328731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33733"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33733"
FT                   /db_xref="GOA:Q8X6J7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6J7"
FT                   /protein_id="BAB33733.2"
FT                   /translation="MSYADSTNPNAPVSMTDKWDKTFAESQKVDHRKVSFPNRYGITLV
FT                   GDLYLPKDRGDRKLAAIAVSGPFGAVKEQSSGLYAQTLAERGFVTLAFDPSYTGESGGY
FT                   PRNVASPDINTEDFSAAVDFLGLQKEVDRNRIGLLGICGWGGMALNDAAMDTRVKAVAT
FT                   SVMYDMSRAMGHGVGDGEDRYSTADRRAVLQYLNEQRWKDAQSGTFAHGGHDINVDSNG
FT                   KVSAGERILPETLPANPHPVLKEFFDYYRMPRGFHERSVNSTGAWTATMPLSFMNMPLL
FT                   SYASEITIPTLIVTGEKAHSRYFAEDAYKAVGSKDKELVVVPGANHVDLYDNVAGKIPF
FT                   AKFEQFFQTKLK"
     MSYADSTNPN APVSMTDKWD KTFAESQKVD HRKVSFPNRY GITLVGDLYL PKDRGDRKLA        60
     AIAVSGPFGA VKEQSSGLYA QTLAERGFVT LAFDPSYTGE SGGYPRNVAS PDINTEDFSA       120
     AVDFLGLQKE VDRNRIGLLG ICGWGGMALN DAAMDTRVKA VATSVMYDMS RAMGHGVGDG       180
     EDRYSTADRR AVLQYLNEQR WKDAQSGTFA HGGHDINVDS NGKVSAGERI LPETLPANPH       240
     PVLKEFFDYY RMPRGFHERS VNSTGAWTAT MPLSFMNMPL LSYASEITIP TLIVTGEKAH       300
     SRYFAEDAYK AVGSKDKELV VVPGANHVDL YDNVAGKIPF AKFEQFFQTK LK               352
//

If you have problems or comments...

PBIL Back to PBIL home page