(data stored in ACNUC7421 zone)

EMBL: BA000007.PE298

BA000007.PE298       Location/Qualifiers
FT   CDS             328873..330000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0311"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33734"
FT                   /db_xref="GOA:Q8X4N6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4N6"
FT                   /protein_id="BAB33734.2"
FT                   /translation="MTLCVFVLIASEFMPVSLLTPIARDLGVTEGLAGRGIAISGALAV
FT                   LTSLTLSTLAGKMNRKFLLLGMTVLMAVSGLIIALATSYLMYMVGRAMIGVAIGGFWSM
FT                   SAATAIRLVPQHQVTRALAIFNAGNALATVVAAPLGSYLGATVGWRGAFLCLVPMAVVA
FT                   FIWQCISLPSMDANKSHTSCGAVFRLFSRRMVVVGMIACGLFFMGQFALFTYVRPFLES
FT                   VTRVNSLGLSLILLIIGVAGFIGTLVVSIFLNRKCYPTLMAIPGLMAVIAIGLMLTGHH
FT                   VWMVSLLLGLWGMLATAAPTGWWTWIARTLPDNAEAGGGLMVAVIQLSIALGSTAGGIV
FT                   FDRLGWQSTFAMSSVLLLCAGVLTFVTARQKAGAL"
     MTLCVFVLIA SEFMPVSLLT PIARDLGVTE GLAGRGIAIS GALAVLTSLT LSTLAGKMNR        60
     KFLLLGMTVL MAVSGLIIAL ATSYLMYMVG RAMIGVAIGG FWSMSAATAI RLVPQHQVTR       120
     ALAIFNAGNA LATVVAAPLG SYLGATVGWR GAFLCLVPMA VVAFIWQCIS LPSMDANKSH       180
     TSCGAVFRLF SRRMVVVGMI ACGLFFMGQF ALFTYVRPFL ESVTRVNSLG LSLILLIIGV       240
     AGFIGTLVVS IFLNRKCYPT LMAIPGLMAV IAIGLMLTGH HVWMVSLLLG LWGMLATAAP       300
     TGWWTWIART LPDNAEAGGG LMVAVIQLSI ALGSTAGGIV FDRLGWQSTF AMSSVLLLCA       360
     GVLTFVTARQ KAGAL                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page