(data stored in ACNUC7421 zone)

EMBL: BA000007.PE319

BA000007.PE319       Location/Qualifiers
FT   CDS             complement(352242..352598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33757"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33757"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6G9"
FT                   /protein_id="BAB33757.1"
FT                   /translation="MNKNLILAFALFSLPVFAEEDLGPGKYVCDIRISSLDTATQILSK
FT                   SATVLDNGNNFIVQMPNGDQLYSPDLENVDDGIKQKATIGGVTFIRRPTFNDRFIVEDG
FT                   NTGFFYKMRNCEKK"
     MNKNLILAFA LFSLPVFAEE DLGPGKYVCD IRISSLDTAT QILSKSATVL DNGNNFIVQM        60
     PNGDQLYSPD LENVDDGIKQ KATIGGVTFI RRPTFNDRFI VEDGNTGFFY KMRNCEKK         118
//

If you have problems or comments...

PBIL Back to PBIL home page