(data stored in ACNUC7421 zone)

EMBL: BA000007.PE33

BA000007.PE33        Location/Qualifiers
FT   CDS             complement(38421..38639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_5362"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X446"
FT                   /protein_id="BBE29392.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRISYSIKLADEKYPP"
     MTRFEAIKQG HIKIVDISIV CNFTVDKCEL NPAYVIKNID SPKDLLNGQK KRSSSENRIS        60
     YSIKLADEKY PP                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page