(data stored in ACNUC7421 zone)

EMBL: BA000007.PE352

BA000007.PE352       Location/Qualifiers
FT   CDS             394397..394807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_5377"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3L2"
FT                   /protein_id="BBE29396.1"
FT                   /translation="MTIKEKFSQKYPHASFCTFGDSAALADHLATLIATGVKTASCGSL
FT                   AGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTAELARKEGEGDLSLEY
FT                   WRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
     MTIKEKFSQK YPHASFCTFG DSAALADHLA TLIATGVKTA SCGSLAGCIE DNAFPMIGEY        60
     KIVENSRGEP VCVIRVIGLH LLRFSDVTAE LARKEGEGDL SLEYWRNEHR RFFQAEGSYS       120
     PEMDVIFEEY ALIDVV                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page