(data stored in ACNUC7421 zone)

EMBL: BA000007.PE377

BA000007.PE377       Location/Qualifiers
FT   CDS             complement(425297..426073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33823"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33823"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X682"
FT                   /protein_id="BAB33823.2"
FT                   /translation="MKITQIRNATQIIQYAGKTFLIDPLLAPKGSYPGFAGTARAEIRN
FT                   PTVELPCDLTTLLNVDALIVTHLHEDHWDETASRVVPKDKLIYVQNEQDAESLNKQGFT
FT                   HLTVLTDETKFGDITLHKTTGQHGSDRTYADPAMAKRLGAACGVVFQHPTEKTLYLAGD
FT                   TLWRDDVEATMLTFQPEVVVLNAGFAHVLGHGAIIMGAEDILKTHFTLPEAQIIATHME
FT                   AVNHCLLTRDALKEYARDNQIIEFVNVPEDGETLTF"
     MKITQIRNAT QIIQYAGKTF LIDPLLAPKG SYPGFAGTAR AEIRNPTVEL PCDLTTLLNV        60
     DALIVTHLHE DHWDETASRV VPKDKLIYVQ NEQDAESLNK QGFTHLTVLT DETKFGDITL       120
     HKTTGQHGSD RTYADPAMAK RLGAACGVVF QHPTEKTLYL AGDTLWRDDV EATMLTFQPE       180
     VVVLNAGFAH VLGHGAIIMG AEDILKTHFT LPEAQIIATH MEAVNHCLLT RDALKEYARD       240
     NQIIEFVNVP EDGETLTF                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page