(data stored in ACNUC7421 zone)

EMBL: BA000007.PE392

BA000007.PE392       Location/Qualifiers
FT   CDS             complement(441345..442376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0415"
FT                   /product="periplasmic-iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33838"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33838"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J1"
FT                   /protein_id="BAB33838.1"
FT                   /translation="MKMTFTSTLIASAVALATLTGAAQAKGRLVVYCSATNEMCEAETK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQAYKSP
FT                   NLEQIMEKFRDPAKVKGNLSSAVYVGILGFGVNTDRLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFAQLWGEDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNAKLFVDWVLSKEA
FT                   QELAWKKGKSYQILTNTTAETSPNSLKLDDLKLINYDMDKYGSTDVRKALINKWVSEVK
FT                   MGK"
     MKMTFTSTLI ASAVALATLT GAAQAKGRLV VYCSATNEMC EAETKAFGEK YDVKTSFIRN        60
     GSGSTLAKVD AEKKNPQADV WYGGTLDPQS QAGEMGLLQA YKSPNLEQIM EKFRDPAKVK       120
     GNLSSAVYVG ILGFGVNTDR LKEKNLPVPK CWKDLTKPEY KGEIQIADPQ SSGTAYTALA       180
     TFAQLWGEDQ AFDYLKQLNA NVSQYTKSGI APARNAARGE TAIGIGFLHD YSLEKEQGAP       240
     LELISPCEGT GYEIGGVSIL KGARNLDNAK LFVDWVLSKE AQELAWKKGK SYQILTNTTA       300
     ETSPNSLKLD DLKLINYDMD KYGSTDVRKA LINKWVSEVK MGK                         343
//

If you have problems or comments...

PBIL Back to PBIL home page