(data stored in ACNUC7421 zone)

EMBL: BA000007.PE393

BA000007.PE393       Location/Qualifiers
FT   CDS             complement(442373..443677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0416"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33839"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33839"
FT                   /db_xref="GOA:Q8X5J0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J0"
FT                   /protein_id="BAB33839.1"
FT                   /translation="MHARSAREINQCYRTLRPRLLMCMIIGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGVGLFATGLLNVVFAFG
FT                   ESLTLLLVVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPQEEGLPTVGHWRHDPLELRQEQQS
FT                   PPMGLWQMLRTTMLQNPLIWLLGVSYVLVYVIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAVCF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYGWP
FT                   GMFSLLSVAAVLMGLLLMPLLMAGITTTHARRIKQ"
     MHARSAREIN QCYRTLRPRL LMCMIIGYAA FYLTRKSVNY VLPALQTDLG LDKGDIGLLG        60
     SLFYLSYGLS KFTAGLWHDS HGQRGFMGVG LFATGLLNVV FAFGESLTLL LVVWTLNGFF       120
     QGWGWPPCAR LLTHWYSRNE RGFWWGCWNM SINIGGAIIP LISAFAAHWW GWQAAMLTPG       180
     IISMALGIWL TLQLKGTPQE EGLPTVGHWR HDPLELRQEQ QSPPMGLWQM LRTTMLQNPL       240
     IWLLGVSYVL VYVIRIALND WGNIWLTESH GVNLLSANAT VMLFEVGGLL GALFAGWGSD       300
     LLFSGQRAPM ILLFTLGLMV SVAALWLAPV HHYALLAVCF FTVGFFVFGP QMLIGLAAVE       360
     CGHKAAAGSI TGFLGLFAYL GAALAGWPLS LVIERYGWPG MFSLLSVAAV LMGLLLMPLL       420
     MAGITTTHAR RIKQ                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page