(data stored in ACNUC7421 zone)

EMBL: BA000007.PE394

BA000007.PE394       Location/Qualifiers
FT   CDS             complement(443762..445303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0417"
FT                   /product="sensor histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33840"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33840"
FT                   /db_xref="GOA:Q8X5I9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I9"
FT                   /protein_id="BAB33840.1"
FT                   /translation="MSRNLRHWVILLFIVLAWGTGWLMLWTLSFYLTNNGQQAVLFLPQ
FT                   GVYLALVILLSRRYWPALVLPPLLMMFWLHSEQLLNGYLMLATPVISLFPALLAQNFWH
FT                   RFPLYWQRLTLLLATVTAASLLNTALLSPFMSGPIMLPGLTSFTGGVLLTPFVYLIFEF
FT                   LRQQHRYQLLGLDTHNPPLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVV
FT                   MAWKFGWQGGVLSGLLGSMMITIARQIGVGFSNLVELEIFLATQALLGIGLGIAISRQQ
FT                   HLALNLHHYRQRLEAELAARRALAEKLIHTEEDTRKNLARELHDEIGQNITAIQIQSQL
FT                   VKRARDPAQIQSAASQINELARRIHLSTRQLLRQLRPPALDELTFREALLHLINEFAFS
FT                   ERGIHCQFAYQLNSTPENETVRFTLYRLLQELLNNICKHAEASEVTIILRQQGEVLHLE
FT                   VSDNGVGIASGKMAGFGIQGMRERVSALGGDLTLEKQHGTRVIVNLPTFLQQIAG"
     MSRNLRHWVI LLFIVLAWGT GWLMLWTLSF YLTNNGQQAV LFLPQGVYLA LVILLSRRYW        60
     PALVLPPLLM MFWLHSEQLL NGYLMLATPV ISLFPALLAQ NFWHRFPLYW QRLTLLLATV       120
     TAASLLNTAL LSPFMSGPIM LPGLTSFTGG VLLTPFVYLI FEFLRQQHRY QLLGLDTHNP       180
     PLRTSLIIWC SLFFIIGIGT QMVLSPEIER LLLIVVFLPN VVMAWKFGWQ GGVLSGLLGS       240
     MMITIARQIG VGFSNLVELE IFLATQALLG IGLGIAISRQ QHLALNLHHY RQRLEAELAA       300
     RRALAEKLIH TEEDTRKNLA RELHDEIGQN ITAIQIQSQL VKRARDPAQI QSAASQINEL       360
     ARRIHLSTRQ LLRQLRPPAL DELTFREALL HLINEFAFSE RGIHCQFAYQ LNSTPENETV       420
     RFTLYRLLQE LLNNICKHAE ASEVTIILRQ QGEVLHLEVS DNGVGIASGK MAGFGIQGMR       480
     ERVSALGGDL TLEKQHGTRV IVNLPTFLQQ IAG                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page