(data stored in ACNUC7421 zone)

EMBL: BA000007.PE420

BA000007.PE420       Location/Qualifiers
FT   CDS             470661..471110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33866"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA3"
FT                   /protein_id="BAB33866.1"
FT                   /translation="MTQRPWSKLQREIYDLLTPTINLQIHCTRYPMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNGGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKNYCPP"
     MTQRPWSKLQ REIYDLLTPT INLQIHCTRY PMRSQNGGST DLPRYWITLD KNVIWDYPKD        60
     FIAGNGGVRN FHGETCWYPY LTDICSISDL LREYIDTPKA ELLTKQFTSD KWGLVNILRA       120
     ADRRIGMRRL DQLRRKTHNI AALKNYCPP                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page