(data stored in ACNUC7421 zone)

EMBL: BA000007.PE431

BA000007.PE431       Location/Qualifiers
FT   CDS             486502..487947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33877"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33877"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE97"
FT                   /protein_id="BAB33877.1"
FT                   /translation="MTISNSNLLKPFITGTELPPFKEDVFSKTEEQFKKSTYGKSLFIS
FT                   GNENLVNISAEKIDEIKNSKNFFSNIVNIIILLIKHPDKILPILHGCPVESIEVIKNAK
FT                   RTGQWSYEMTDKNGQSIEVSYIFTDTIDDKSDGKLCLKICNSCNQNDSSTHEYKIDHQQ
FT                   LKNHIRQLEEWALLEKFYDNNAYYSKRTKQLEKKIADAGFITRKVKAENFNVKEFKDDI
FT                   ASMLCEQPPMRTHQISSSGYVSADKLHKLYKTNLEDAQRDLKTTPVDIDGVSLKSITRE
FT                   KIAEEIAKKTAEIIAKQNAKSIEEKNIEKNKKQTNSEDNFVLKFSPEEINEMLLDYSDE
FT                   EQKKLRPFFTSDHIYCLFDAFSQGLHNVARNGSPRYAGLLRQIASKSAILQDFDQQLFW
FT                   RTFTGGVLHRHISVKSEPEKTDVWRFSSQFDFPHINENGELSRTVLMFEGVAESNFKDI
FT                   ANHSSECFSYRCYAAPLDANAKK"
     MTISNSNLLK PFITGTELPP FKEDVFSKTE EQFKKSTYGK SLFISGNENL VNISAEKIDE        60
     IKNSKNFFSN IVNIIILLIK HPDKILPILH GCPVESIEVI KNAKRTGQWS YEMTDKNGQS       120
     IEVSYIFTDT IDDKSDGKLC LKICNSCNQN DSSTHEYKID HQQLKNHIRQ LEEWALLEKF       180
     YDNNAYYSKR TKQLEKKIAD AGFITRKVKA ENFNVKEFKD DIASMLCEQP PMRTHQISSS       240
     GYVSADKLHK LYKTNLEDAQ RDLKTTPVDI DGVSLKSITR EKIAEEIAKK TAEIIAKQNA       300
     KSIEEKNIEK NKKQTNSEDN FVLKFSPEEI NEMLLDYSDE EQKKLRPFFT SDHIYCLFDA       360
     FSQGLHNVAR NGSPRYAGLL RQIASKSAIL QDFDQQLFWR TFTGGVLHRH ISVKSEPEKT       420
     DVWRFSSQFD FPHINENGEL SRTVLMFEGV AESNFKDIAN HSSECFSYRC YAAPLDANAK       480
     K                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page