(data stored in ACNUC7421 zone)

EMBL: BA000007.PE439

BA000007.PE439       Location/Qualifiers
FT   CDS             494492..494773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0462"
FT                   /product="plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33885"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33885"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE95"
FT                   /protein_id="BAB33885.1"
FT                   /translation="MYKLSGKAVEDFRGIYDYTLGKFGDEQADRYTDSLGTFLDTLSQM
FT                   PEIGQDYDAIPEVKKIAFRFHTVYYVIRVDDILIARILHQLMEPRRHW"
     MYKLSGKAVE DFRGIYDYTL GKFGDEQADR YTDSLGTFLD TLSQMPEIGQ DYDAIPEVKK        60
     IAFRFHTVYY VIRVDDILIA RILHQLMEPR RHW                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page