(data stored in ACNUC7421 zone)

EMBL: BA000007.PE50

BA000007.PE50        Location/Qualifiers
FT   CDS             55039..55353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0053"
FT                   /product="CcdB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33476"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33476"
FT                   /db_xref="GOA:Q8XA16"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA16"
FT                   /protein_id="BAB33476.1"
FT                   /translation="MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
     MQFTVYRSRS RNAAFPFVID VTSDIIGVIN RRIVIPLTPI ERFSRIRPPE RLNPILLLVD        60
     GKEYVLMTHE TATVPVNALG TKFCDASAHR TLIKGALDFM LDGI                        104
//

If you have problems or comments...

PBIL Back to PBIL home page