(data stored in ACNUC7421 zone)

EMBL: BA000007.PE517

BA000007.PE517       Location/Qualifiers
FT   CDS             579896..581251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0540"
FT                   /product="outer membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33963"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33963"
FT                   /db_xref="GOA:Q8XD20"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD20"
FT                   /protein_id="BAB33963.1"
FT                   /translation="MARFQFKNRKNNGLIFFISFMVMGEAAIAAPLPQWANAPAVTPVA
FT                   QLSLQESILRAFARNPGVTQQAAQIGIGEAQIDEAKSAWYPHVGLTGNAGPSRQTDSSG
FT                   RLDNNVSYGITLTQLVYDFGKTNNDINLQTAARDSYRFKLMATLTDVAEKTATAYMEVS
FT                   RYQALCDAAQRNIHSLENVYNMAALRANAGLNSSSDELQAQTRIAGMRSTLEQYQAQMA
FT                   SAKAQLAVLTGVQPEAIAAPPAELAEQPVSLKNIDYQSIPLVLAAENLRQSAQYGVEKT
FT                   KAQYWPTLSIQGGKTRYQTSDRSYWDDQLQLNVNAPLYQGGAVSAQVQQAEGQQKISAS
FT                   QVEQAKLDVLQRASVAYANWTGARGREEAGLAQSESAHKTRDVYQNEYKLGKRSLNDLL
FT                   TVEQDVFQAQSAEINANYDGWVAAVNYAAAVNNLIPLAGIKQGLYNDLPDLK"
     MARFQFKNRK NNGLIFFISF MVMGEAAIAA PLPQWANAPA VTPVAQLSLQ ESILRAFARN        60
     PGVTQQAAQI GIGEAQIDEA KSAWYPHVGL TGNAGPSRQT DSSGRLDNNV SYGITLTQLV       120
     YDFGKTNNDI NLQTAARDSY RFKLMATLTD VAEKTATAYM EVSRYQALCD AAQRNIHSLE       180
     NVYNMAALRA NAGLNSSSDE LQAQTRIAGM RSTLEQYQAQ MASAKAQLAV LTGVQPEAIA       240
     APPAELAEQP VSLKNIDYQS IPLVLAAENL RQSAQYGVEK TKAQYWPTLS IQGGKTRYQT       300
     SDRSYWDDQL QLNVNAPLYQ GGAVSAQVQQ AEGQQKISAS QVEQAKLDVL QRASVAYANW       360
     TGARGREEAG LAQSESAHKT RDVYQNEYKL GKRSLNDLLT VEQDVFQAQS AEINANYDGW       420
     VAAVNYAAAV NNLIPLAGIK QGLYNDLPDL K                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page