(data stored in ACNUC7421 zone)

EMBL: BA000007.PE518

BA000007.PE518       Location/Qualifiers
FT   CDS             581354..585739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33964"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCK7"
FT                   /protein_id="BAB33964.1"
FT                   /translation="MSLIIDVISRKTSVKQTLINPGDVTVVIYEPSVVQVHAQASAVAR
FT                   YVREGNDLLIYMQDGTVIRCNGYFLQAANTAEQSELVFADGQQLTHITFADTAAGGLAP
FT                   VELTAQTTAIESIAPFLDTVAQTSAFPWGWLAGAAVGGGALGALLASGGDGDSKTEVIN
FT                   NPTPPAEPGNATPSFLVTDNQGDQRGILATNDITDDTTPTFSGSGQAGATIQIKDSNGN
FT                   TIASTQVDNNGHWSVSLPTQSAGEHTWSVVQIVGSTITDAGSITLTIDNSQASVQVATT
FT                   AGDNIINASEQAAGFTLSGTSSHLAQGTELTVTLNGKTYTTSVGANGAWSVQVPTADAQ
FT                   ALGEGNQAVLVSGKDATGNTVTGAQLLTVDTQPPTLAINTIAQDNIISAAEHNVALVLS
FT                   GTSNAEAGQTVTLTVNGKSHTATVGSDGTWQVTLPATEVQALAEGNYAVNASVSDRAGN
FT                   TTSHSANFTVDTSAPVVSVNTVAGDDILNNAEQAVAQIISGQVSGASPGDTVTVKLGTH
FT                   VLTGIVLADGSWNVALDPAVTRTLDRGANTIFVTVTDAAGNTGAASRAITLVGVSPLIT
FT                   INTVSGDDIISGAEKGAPLTLTGSTQQAETGQTVTVTLAGQSFTTTVQADGSWSLTVPA
FT                   AAMGNLPDGAVAITASVTDLSGNTGNTSRTITVDSQAPALSIDPLTADNIINAAESGQD
FT                   LPITGTTDAQPGQTVTVTLNGQTYQGVVQPDGTWSVTVPAANVGALADGNATVTASVND
FT                   VAGNPSSVSRVALVDATPPVVTINPVATDNVINTPEHAQAQIISGTVTGAQAGDIVTVT
FT                   LNNVDYTTVVDGSGNWSLGVPASVVSGLADGSYPVSVSVTDKAGNTGSQSLTVTVNTAA
FT                   PLIGINSIAGDDVINASEKGADLQITGTSDQPVNTAITVTLNGQNYTTTTDASGNWSVT
FT                   VPASAVTALGQANYTVTAAVTSDIGNSATASHNVLVDSALPGVTINPVATDDIINAAEA
FT                   GVAQTISGQVTGAEDGDTVTITLGGNTYTATVGSNLTWSVDVPAADIQALGNGDLTVNA
FT                   SVTNQNGNTGSGTRDITIDANLPGLRVDTVAGDDVVNIIEHGQALVVTGSSSGLAESTP
FT                   LTVTINNVEYTTAVQADGSWSVGVTAAQVSAWPAGTVNIAVSGESSAGNSVSITHPVTV
FT                   DLTPAAITINTIATDDVINAAEKGADLTLSGTTTNVEPGQTVTVTFGGKNYTASVASDG
FT                   SWTATVPAADLASLPEGSASALASVSNINGNSASAVHNYSVDSSAPTIIINTVASDNIV
FT                   NASEADAGVTVSGSTTAEAGQIVTITLNSPTVQTYQATVQADGSWSINIPAADLEALTD
FT                   GSHTLTATVNDKAGNPASTTHNLAVDLTVPVLTINTIAGDDIINATEHGQALVISGSST
FT                   GGEAGDVVTVTLNSKTYTTTLDASGNWSVGVPAADVTALGSGPQTVTATVTDAAGNSDN
FT                   "
     MSLIIDVISR KTSVKQTLIN PGDVTVVIYE PSVVQVHAQA SAVARYVREG NDLLIYMQDG        60
     TVIRCNGYFL QAANTAEQSE LVFADGQQLT HITFADTAAG GLAPVELTAQ TTAIESIAPF       120
     LDTVAQTSAF PWGWLAGAAV GGGALGALLA SGGDGDSKTE VINNPTPPAE PGNATPSFLV       180
     TDNQGDQRGI LATNDITDDT TPTFSGSGQA GATIQIKDSN GNTIASTQVD NNGHWSVSLP       240
     TQSAGEHTWS VVQIVGSTIT DAGSITLTID NSQASVQVAT TAGDNIINAS EQAAGFTLSG       300
     TSSHLAQGTE LTVTLNGKTY TTSVGANGAW SVQVPTADAQ ALGEGNQAVL VSGKDATGNT       360
     VTGAQLLTVD TQPPTLAINT IAQDNIISAA EHNVALVLSG TSNAEAGQTV TLTVNGKSHT       420
     ATVGSDGTWQ VTLPATEVQA LAEGNYAVNA SVSDRAGNTT SHSANFTVDT SAPVVSVNTV       480
     AGDDILNNAE QAVAQIISGQ VSGASPGDTV TVKLGTHVLT GIVLADGSWN VALDPAVTRT       540
     LDRGANTIFV TVTDAAGNTG AASRAITLVG VSPLITINTV SGDDIISGAE KGAPLTLTGS       600
     TQQAETGQTV TVTLAGQSFT TTVQADGSWS LTVPAAAMGN LPDGAVAITA SVTDLSGNTG       660
     NTSRTITVDS QAPALSIDPL TADNIINAAE SGQDLPITGT TDAQPGQTVT VTLNGQTYQG       720
     VVQPDGTWSV TVPAANVGAL ADGNATVTAS VNDVAGNPSS VSRVALVDAT PPVVTINPVA       780
     TDNVINTPEH AQAQIISGTV TGAQAGDIVT VTLNNVDYTT VVDGSGNWSL GVPASVVSGL       840
     ADGSYPVSVS VTDKAGNTGS QSLTVTVNTA APLIGINSIA GDDVINASEK GADLQITGTS       900
     DQPVNTAITV TLNGQNYTTT TDASGNWSVT VPASAVTALG QANYTVTAAV TSDIGNSATA       960
     SHNVLVDSAL PGVTINPVAT DDIINAAEAG VAQTISGQVT GAEDGDTVTI TLGGNTYTAT      1020
     VGSNLTWSVD VPAADIQALG NGDLTVNASV TNQNGNTGSG TRDITIDANL PGLRVDTVAG      1080
     DDVVNIIEHG QALVVTGSSS GLAESTPLTV TINNVEYTTA VQADGSWSVG VTAAQVSAWP      1140
     AGTVNIAVSG ESSAGNSVSI THPVTVDLTP AAITINTIAT DDVINAAEKG ADLTLSGTTT      1200
     NVEPGQTVTV TFGGKNYTAS VASDGSWTAT VPAADLASLP EGSASALASV SNINGNSASA      1260
     VHNYSVDSSA PTIIINTVAS DNIVNASEAD AGVTVSGSTT AEAGQIVTIT LNSPTVQTYQ      1320
     ATVQADGSWS INIPAADLEA LTDGSHTLTA TVNDKAGNPA STTHNLAVDL TVPVLTINTI      1380
     AGDDIINATE HGQALVISGS STGGEAGDVV TVTLNSKTYT TTLDASGNWS VGVPAADVTA      1440
     LGSGPQTVTA TVTDAAGNSD N                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page