(data stored in ACNUC7421 zone)

EMBL: BA000007.PE519

BA000007.PE519       Location/Qualifiers
FT   CDS             585947..601822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33965"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33965"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JG23"
FT                   /protein_id="BAB33965.1"
FT                   /translation="MPASAVGALGEASYTVTANVTDSAGNSNSASHNVQVNTALPGVTI
FT                   NPVATDDIINAAESGNAQTISGQVTGAAAGDTVTVTLGGKTYTATVQGNLSWSVDVPAA
FT                   DIQAIGNGNLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVVNSIEHAQAL
FT                   VITGSSSGLAAGAALTVVINTVTYAATVLADGTWSVGVPAADVSNWPAGTVNITVSGTN
FT                   TAGTTSTITHPVTVDLAAVAISINTVSGDDVINAAEKGADLTLSGSTSGVEVGQTVTVT
FT                   FGGKTYTATVAGDGSWTTTVPAADLSVLRDGDATVQASVSTINGNTASATHAYSVDATA
FT                   PTLAINTIATDDILNAAEAGNPLTISGSSTAEAGQTVTVTLNGVTYSGSVQADGSWSVS
FT                   LPTADLSNLTASQYTVSASVSDKAGNPASANHGLAVDLTVPVLTINTVSGDDIINAAEH
FT                   GQALVISGSSTGGEAGDVITVTLNSKTYTTMLDASGNWSVGVPAADVTALGSGPQTITA
FT                   AITDAAGNSDDASRTVTVNLAAPTIGINTIATDDVIKATEKGADLQITGTSNQPAGTTI
FT                   TVTLNGQNYTATTDSNGNWSATVPASAVSALGEANYTVTANVTDTAGNSNSASHNVLVN
FT                   SALPAVTINAVATDDIINAAESGNAQTISGQVTGAAQGDTVTVTLGGNTYTATVQSNLS
FT                   WSVDVPAADIQALGNGDLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVIN
FT                   SIEHNQALVITGSSSGLTAGTALTVEINNVTYGATVLADGTWSLGVPAVDVSNWPAGTV
FT                   NITVSGTNSAGTTSTITHPVTVDLAGVAITINTLSGDDVINAVEKGETLVVSGSTSGVE
FT                   AGQTVTVTFGGKNYTTTVEANGSWTVNVPPADLAALPDGAGNVQASVSNINGNSAQADR
FT                   AYSVDATAPLVTINTIASDDILNVSEAGAGITISGTTTAQAGQTLTVTLNNNTYQTTVL
FT                   ADGTWSVNVPAADLSGLTASSYTVTATVSDKAGNPASADHALVVDITAPDLTINTVAGD
FT                   DIINAIEHGQALVVSGTSTGAAAGDVVTVTLNGKNYTTTLDASGNWSVGIPAADVTALA
FT                   TGSQTITASLSDRAGNSDSTTHDVTVDLSGPTLTINTVSGDDIINAAEIVVAQTISGQV
FT                   TGTAVAGNTVIVTIGGNQYNATVQSDLSWSVSVPANVLQALGNGELTISASLTNSANNT
FT                   GTATHDIVIDANLPGLRVDTVAGDDVINSIEHTQALVITGSSSGLAAGAALTVVINSVT
FT                   YGATVLADGSWSVGVPVADVTNWPAGTVNIAVSGTNTAGTTTSISHPVTVDLAAVAITI
FT                   NTLSTDDVINAAEKGSDLQLSGTTSGVEAGQTITVIFGGKSYTTTVAADNTWGLTIPAV
FT                   DVATLPDGAANVQASVSNVAGNSTQATHAYSVDATAPSVTINTIATDDILNAAEAGSAL
FT                   TISGTSTAEAGQTVTVTLNGVNYSGNVQADGSWSVSVPTGDLASLTASSYTVNASVSDK
FT                   ARNSASATHNLTVDLAAPVVTINTVAGDDIINATEHGQAQIISGSATGATTGNTVSVTI
FT                   GTTTYTTVLDANGNWSIGVPASVISALAQGDVTITATVTDSAGNSGTASHTVTVALGAP
FT                   VLAINTIAVDDIINAAEKGADLAITGTSNQPAGTQITVTLNGQNYTTTADASGNWSVTV
FT                   PASRVSALGEATYTVTAAATDADGNSGSASHNVQVNTALPGVTINVVATDDIINAAEAG
FT                   VEQTISGQVTGAAAGDTVTVTLGGATYTATVQANLSWSVDVPASALQELGNGELTISAS
FT                   VTNSVGNTGNGTREITIDANLPGLRVDTVAGDDVVNIIEHGQALVITGSSSGLAAGSNV
FT                   TLTINGQTYVAAVLADGTWSVGVPAVDVSAWPAGSVTIAASGSTSAGNPVSVTHPVTVD
FT                   LSAVAVSINAITADDVINAAEKGAALTLSGSTSGVEAGQTVTVTFGGKTYSATVAANGS
FT                   WSTSVPAADMAALRDGDASAQASVSNVNGNSATTTHAYSVDASAPTVTINTIAGDDILN
FT                   AAEAGAALTITGSSTAEAGQTVTVTLNGTNYTGTVQTDGSWSVSVPSADLSTLTASNYT
FT                   VNAAVSDKAGNPASVNHNLTVDTSVPVVTINTVAGDDVINATEHAQAQIISGSATGAAT
FT                   GSTVTVTIGTNTFTTVLDASGNWSVGVPASVVSALANGTVTINASVTDAGGNSGSATHQ
FT                   VTVNTGLPTITFNAISGDNILNADEKGQPLTISGGSTGLATGAQVTVTLNGHNYSATTD
FT                   ASGNWTLTVPVSDLAALGQANYTVSASATSAAGNTASSQANLLVDSGLPDVTINTVAGD
FT                   DIINAAEAGADQTISGVVTRAAAGDTVTVTLGGNTYTATVQSNLSWSVSVPTADLQALG
FT                   NGDLTITASVTNANGNTGSGTRDITIDANLPGLRVDTVAGDDIVNSIEHGQALVITGGS
FT                   SGLNAGAVLTVTINSVAYSATVQADGSWSVGIPAANVSAWPAGPLTVEVDGQSSANNPV
FT                   SVSHPFTVDLTAVAISINTVASDDVINAAEKGTNLTLSGSTSGIESGQTVTVTFGGKTY
FT                   TASVAANGSWSVNVPAADLATLPEGAANVQASVSSASGNSASATHAYSVDASAPTLTIN
FT                   TIASDDILNAAEAGSPLTISGTSTAETGQTVTVTLNGATYTGTVQADGSWSVSVPTSAL
FT                   GALNASNYTVSATVNDKAGNPGSASHNLAVDTTAPVLTINTVAGDDIINDAEHAQALVI
FT                   SGTSSGGEAGDVVSVVLNGKTYTTTLDASGNWSVGVPAADVTALGSGAQTITASVSDRA
FT                   GNSDDASRTVTVSLSAPVISINTIAGDDVINATEKGSDLALSGTSDQPAGTAITVTLNG
FT                   QNYSATTDASGNWSVTVPASAVSALGEATYSVTASVTNAQGNSSTASHNVQVNTALPGI
FT                   TINPVATDDIINASEAGSAQTISGQVTGAAAGSTVTVELGGKTYTATVQADLSWNVSVP
FT                   AADWQALGNGELTVNASVTNAVGNTGSGTRDITIDASLPGLRVDTVAGDDVVNIIEHAQ
FT                   AQVITGSSSGFAAGTALTVVINNQTYAATVLANGSWSVGVPATDVSNWPAGTLNITVSG
FT                   ANSAGTQTSITHPLTVDLTAVAISMNSITSDDAINAAEKGAALTLSGSTSGVEAGQTVT
FT                   VTFGGKTYTTTVAANGSWSTTVPAADLAALRDGDASAQVRVTNVNGNSATATHEYSVDS
FT                   AAPTVTINTIASDNIINASEAAAGVTVSGTSTAQTGQTLTVTLNGTNYQTTVQTDGSWS
FT                   LTLPASDLTALANNGYTLTATVSDLAGNLGSASKGVTVDTTAPVISFNTVAGDDVINNV
FT                   EHIQAQIISGTATGAVAGDRLVVTIAGQQYVTSTDASGNWSVGVPASVISGLADGTVTI
FT                   SATITDSAGNSSTQTHNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATG
FT                   TVVTVLLNGKGYSATIQSNGSWSVNVPAADVAALSDGTSYTVSASAQDSAGNGNSSTQT
FT                   HNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATGTVVTVLLNGKGYSAT
FT                   IQSNGSWSVNVPAADVAALSDGTSYTVSASAQDSAGNSATASRSVAVDLTAPVISINTV
FT                   STDDRLNAAEQQQPLTLNGSTSAEVGQTVTVTFGGKTYTATVAANGTWALNVPAVDLAA
FT                   LGQGAQTITASVNDRAGNPGQATHALTVDTVAPTVTIATVAGDDIINNAEQLAGQTISG
FT                   TTTAEVGQTVTVTFNGQTWSATVGSGGSWSVFIPAQQFAGLSDGSYTISATVSDQAGNP
FT                   GSASRGVTLNGDVPTVTINTFAGDDVVNAAEHGSSLVISGTTTAPVGQTLTLTLNGKTY
FT                   TTTVQTGGSWSYTLGSADVTALADGNAYVINASVSNAIGNTGSSNHTITVDLSAPAMGI
FT                   NIDSLQADTGLSASDFITSVSPVVVNGSLTAALASNETAQISIDGGTTWTTLTVTGTTW
FT                   RYNDSRTLTDGNYLYQVRVIDAAGNVGATDSQNVVIDTTAPDPAVKTIAISAITTDMGL
FT                   ITNDFVTSDTTLAVSGTLGATLSAGEFAQISLDGGVTWTTLTVVGTSWSYADGHTLTDG
FT                   TWNYTVRVVDLAGNVGQTATQNVVVDTTSPEAAKSITITGISDDTGTSSSDFITSDTTL
FT                   TVRGVLGAALGANEFAQISTDNGATWVNVTVAADSLNWSYVDGRTLTNGTTTWQVRVVD
FT                   LAGNVGATSSQSALIDTVNPAQVLTIASISTDTGSSATDFITSDTMLTLTGSLGAGLAS
FT                   GEVAQISLDSGATWTTLTTNGTQWTYTDSRTLTDGSYVYQVRVLDLAGNTGPVVSKTVV
FT                   VDTINPTATPTIVSYTDDVGQRQGTLSSSQATDDTTPLLNGVLSAPLASGEVVYLYRNG
FT                   LLLGAVTMVGALNWTYSDSGLVSGAYTYSARVVDLAGNITSSSDFVLTVDTSIPTTLAQ
FT                   ITSQTTRDTTPIISGVITAALASGQYVEVVINGKTYTSEPGGAVVVDPAHNTWYVQLPD
FT                   TDALTVSATAYTVTAQVKSSAGNGNNANISNGTVTVNAAIDYTPTWTTASKTTAWGLTY
FT                   GLDSHGMWTVLANQQVMQSTDPLTWSKTALTLYQSGNNYATSSIADYDRNGTGDLFITR
FT                   DDYGTGYINGFTNNGDGTFSSAIQVTVGTLTWYGSIVAFDKEGDGYLDFWIGDAGGPDS
FT                   NTFLWNNAGTLVGNSTTSNSGGSATVGGAVTGYLSLNEGSGVDLNNDGRIDLVQHTYNL
FT                   NNYYTLSSLINQGNGTFVWGQNTTNTFLSGAGSGAMSSSVSMTWADFDGDGDMDLFLPA
FT                   SQGRANYGSLLFNTNGVLGCPVAVGATATTYASQFSLAVDWNHDGLMDIARIAQTGQSY
FT                   LYTNVSNASNWTQSALGGSQSGTTSGVAAMDYDWDGAVDVLVSKQSGSVFLSRNTNTVS
FT                   YGTSLHLRITDPNGINVYYGNTVKLYNSAGVLVATQIINPQSGMGVNDTSALVNFYGLN
FT                   AGETYNAVLIKSTGTTASNIDQTVNTSWGGLQATDATHAYDLSAEAGTASNNGKFVGTG
FT                   YNDTFFATAGTDTYDGSGGWVYSSGTGTWLANGGMDVVDFRLSTVGVTANLSSTAAQAT
FT                   GFNTSTFTNIEGISGSNFNDILTGSSGDNQLEGRGGNDTLNIGNGGHDTLLYKLLNASD
FT                   ATGGNGSDVVNGFTVGTWEGTADTDRIDIRELLQGSGYTGNGKASYVNGVATLDAQAGN
FT                   IGDFVKVTQSGSDTIVQIDRDGTGGTFATTNVVTLTGVHTDLATLLANHQLMVV"
     MPASAVGALG EASYTVTANV TDSAGNSNSA SHNVQVNTAL PGVTINPVAT DDIINAAESG        60
     NAQTISGQVT GAAAGDTVTV TLGGKTYTAT VQGNLSWSVD VPAADIQAIG NGNLTVNASV       120
     TNGVGNTGSG SRDITIDANL PGLRVDTVAG DDVVNSIEHA QALVITGSSS GLAAGAALTV       180
     VINTVTYAAT VLADGTWSVG VPAADVSNWP AGTVNITVSG TNTAGTTSTI THPVTVDLAA       240
     VAISINTVSG DDVINAAEKG ADLTLSGSTS GVEVGQTVTV TFGGKTYTAT VAGDGSWTTT       300
     VPAADLSVLR DGDATVQASV STINGNTASA THAYSVDATA PTLAINTIAT DDILNAAEAG       360
     NPLTISGSST AEAGQTVTVT LNGVTYSGSV QADGSWSVSL PTADLSNLTA SQYTVSASVS       420
     DKAGNPASAN HGLAVDLTVP VLTINTVSGD DIINAAEHGQ ALVISGSSTG GEAGDVITVT       480
     LNSKTYTTML DASGNWSVGV PAADVTALGS GPQTITAAIT DAAGNSDDAS RTVTVNLAAP       540
     TIGINTIATD DVIKATEKGA DLQITGTSNQ PAGTTITVTL NGQNYTATTD SNGNWSATVP       600
     ASAVSALGEA NYTVTANVTD TAGNSNSASH NVLVNSALPA VTINAVATDD IINAAESGNA       660
     QTISGQVTGA AQGDTVTVTL GGNTYTATVQ SNLSWSVDVP AADIQALGNG DLTVNASVTN       720
     GVGNTGSGSR DITIDANLPG LRVDTVAGDD VINSIEHNQA LVITGSSSGL TAGTALTVEI       780
     NNVTYGATVL ADGTWSLGVP AVDVSNWPAG TVNITVSGTN SAGTTSTITH PVTVDLAGVA       840
     ITINTLSGDD VINAVEKGET LVVSGSTSGV EAGQTVTVTF GGKNYTTTVE ANGSWTVNVP       900
     PADLAALPDG AGNVQASVSN INGNSAQADR AYSVDATAPL VTINTIASDD ILNVSEAGAG       960
     ITISGTTTAQ AGQTLTVTLN NNTYQTTVLA DGTWSVNVPA ADLSGLTASS YTVTATVSDK      1020
     AGNPASADHA LVVDITAPDL TINTVAGDDI INAIEHGQAL VVSGTSTGAA AGDVVTVTLN      1080
     GKNYTTTLDA SGNWSVGIPA ADVTALATGS QTITASLSDR AGNSDSTTHD VTVDLSGPTL      1140
     TINTVSGDDI INAAEIVVAQ TISGQVTGTA VAGNTVIVTI GGNQYNATVQ SDLSWSVSVP      1200
     ANVLQALGNG ELTISASLTN SANNTGTATH DIVIDANLPG LRVDTVAGDD VINSIEHTQA      1260
     LVITGSSSGL AAGAALTVVI NSVTYGATVL ADGSWSVGVP VADVTNWPAG TVNIAVSGTN      1320
     TAGTTTSISH PVTVDLAAVA ITINTLSTDD VINAAEKGSD LQLSGTTSGV EAGQTITVIF      1380
     GGKSYTTTVA ADNTWGLTIP AVDVATLPDG AANVQASVSN VAGNSTQATH AYSVDATAPS      1440
     VTINTIATDD ILNAAEAGSA LTISGTSTAE AGQTVTVTLN GVNYSGNVQA DGSWSVSVPT      1500
     GDLASLTASS YTVNASVSDK ARNSASATHN LTVDLAAPVV TINTVAGDDI INATEHGQAQ      1560
     IISGSATGAT TGNTVSVTIG TTTYTTVLDA NGNWSIGVPA SVISALAQGD VTITATVTDS      1620
     AGNSGTASHT VTVALGAPVL AINTIAVDDI INAAEKGADL AITGTSNQPA GTQITVTLNG      1680
     QNYTTTADAS GNWSVTVPAS RVSALGEATY TVTAAATDAD GNSGSASHNV QVNTALPGVT      1740
     INVVATDDII NAAEAGVEQT ISGQVTGAAA GDTVTVTLGG ATYTATVQAN LSWSVDVPAS      1800
     ALQELGNGEL TISASVTNSV GNTGNGTREI TIDANLPGLR VDTVAGDDVV NIIEHGQALV      1860
     ITGSSSGLAA GSNVTLTING QTYVAAVLAD GTWSVGVPAV DVSAWPAGSV TIAASGSTSA      1920
     GNPVSVTHPV TVDLSAVAVS INAITADDVI NAAEKGAALT LSGSTSGVEA GQTVTVTFGG      1980
     KTYSATVAAN GSWSTSVPAA DMAALRDGDA SAQASVSNVN GNSATTTHAY SVDASAPTVT      2040
     INTIAGDDIL NAAEAGAALT ITGSSTAEAG QTVTVTLNGT NYTGTVQTDG SWSVSVPSAD      2100
     LSTLTASNYT VNAAVSDKAG NPASVNHNLT VDTSVPVVTI NTVAGDDVIN ATEHAQAQII      2160
     SGSATGAATG STVTVTIGTN TFTTVLDASG NWSVGVPASV VSALANGTVT INASVTDAGG      2220
     NSGSATHQVT VNTGLPTITF NAISGDNILN ADEKGQPLTI SGGSTGLATG AQVTVTLNGH      2280
     NYSATTDASG NWTLTVPVSD LAALGQANYT VSASATSAAG NTASSQANLL VDSGLPDVTI      2340
     NTVAGDDIIN AAEAGADQTI SGVVTRAAAG DTVTVTLGGN TYTATVQSNL SWSVSVPTAD      2400
     LQALGNGDLT ITASVTNANG NTGSGTRDIT IDANLPGLRV DTVAGDDIVN SIEHGQALVI      2460
     TGGSSGLNAG AVLTVTINSV AYSATVQADG SWSVGIPAAN VSAWPAGPLT VEVDGQSSAN      2520
     NPVSVSHPFT VDLTAVAISI NTVASDDVIN AAEKGTNLTL SGSTSGIESG QTVTVTFGGK      2580
     TYTASVAANG SWSVNVPAAD LATLPEGAAN VQASVSSASG NSASATHAYS VDASAPTLTI      2640
     NTIASDDILN AAEAGSPLTI SGTSTAETGQ TVTVTLNGAT YTGTVQADGS WSVSVPTSAL      2700
     GALNASNYTV SATVNDKAGN PGSASHNLAV DTTAPVLTIN TVAGDDIIND AEHAQALVIS      2760
     GTSSGGEAGD VVSVVLNGKT YTTTLDASGN WSVGVPAADV TALGSGAQTI TASVSDRAGN      2820
     SDDASRTVTV SLSAPVISIN TIAGDDVINA TEKGSDLALS GTSDQPAGTA ITVTLNGQNY      2880
     SATTDASGNW SVTVPASAVS ALGEATYSVT ASVTNAQGNS STASHNVQVN TALPGITINP      2940
     VATDDIINAS EAGSAQTISG QVTGAAAGST VTVELGGKTY TATVQADLSW NVSVPAADWQ      3000
     ALGNGELTVN ASVTNAVGNT GSGTRDITID ASLPGLRVDT VAGDDVVNII EHAQAQVITG      3060
     SSSGFAAGTA LTVVINNQTY AATVLANGSW SVGVPATDVS NWPAGTLNIT VSGANSAGTQ      3120
     TSITHPLTVD LTAVAISMNS ITSDDAINAA EKGAALTLSG STSGVEAGQT VTVTFGGKTY      3180
     TTTVAANGSW STTVPAADLA ALRDGDASAQ VRVTNVNGNS ATATHEYSVD SAAPTVTINT      3240
     IASDNIINAS EAAAGVTVSG TSTAQTGQTL TVTLNGTNYQ TTVQTDGSWS LTLPASDLTA      3300
     LANNGYTLTA TVSDLAGNLG SASKGVTVDT TAPVISFNTV AGDDVINNVE HIQAQIISGT      3360
     ATGAVAGDRL VVTIAGQQYV TSTDASGNWS VGVPASVISG LADGTVTISA TITDSAGNSS      3420
     TQTHNVQVNT AAVSLSVSTI SGDNLINAAE AGSALTLSGT GTNFATGTVV TVLLNGKGYS      3480
     ATIQSNGSWS VNVPAADVAA LSDGTSYTVS ASAQDSAGNG NSSTQTHNVQ VNTAAVSLSV      3540
     STISGDNLIN AAEAGSALTL SGTGTNFATG TVVTVLLNGK GYSATIQSNG SWSVNVPAAD      3600
     VAALSDGTSY TVSASAQDSA GNSATASRSV AVDLTAPVIS INTVSTDDRL NAAEQQQPLT      3660
     LNGSTSAEVG QTVTVTFGGK TYTATVAANG TWALNVPAVD LAALGQGAQT ITASVNDRAG      3720
     NPGQATHALT VDTVAPTVTI ATVAGDDIIN NAEQLAGQTI SGTTTAEVGQ TVTVTFNGQT      3780
     WSATVGSGGS WSVFIPAQQF AGLSDGSYTI SATVSDQAGN PGSASRGVTL NGDVPTVTIN      3840
     TFAGDDVVNA AEHGSSLVIS GTTTAPVGQT LTLTLNGKTY TTTVQTGGSW SYTLGSADVT      3900
     ALADGNAYVI NASVSNAIGN TGSSNHTITV DLSAPAMGIN IDSLQADTGL SASDFITSVS      3960
     PVVVNGSLTA ALASNETAQI SIDGGTTWTT LTVTGTTWRY NDSRTLTDGN YLYQVRVIDA      4020
     AGNVGATDSQ NVVIDTTAPD PAVKTIAISA ITTDMGLITN DFVTSDTTLA VSGTLGATLS      4080
     AGEFAQISLD GGVTWTTLTV VGTSWSYADG HTLTDGTWNY TVRVVDLAGN VGQTATQNVV      4140
     VDTTSPEAAK SITITGISDD TGTSSSDFIT SDTTLTVRGV LGAALGANEF AQISTDNGAT      4200
     WVNVTVAADS LNWSYVDGRT LTNGTTTWQV RVVDLAGNVG ATSSQSALID TVNPAQVLTI      4260
     ASISTDTGSS ATDFITSDTM LTLTGSLGAG LASGEVAQIS LDSGATWTTL TTNGTQWTYT      4320
     DSRTLTDGSY VYQVRVLDLA GNTGPVVSKT VVVDTINPTA TPTIVSYTDD VGQRQGTLSS      4380
     SQATDDTTPL LNGVLSAPLA SGEVVYLYRN GLLLGAVTMV GALNWTYSDS GLVSGAYTYS      4440
     ARVVDLAGNI TSSSDFVLTV DTSIPTTLAQ ITSQTTRDTT PIISGVITAA LASGQYVEVV      4500
     INGKTYTSEP GGAVVVDPAH NTWYVQLPDT DALTVSATAY TVTAQVKSSA GNGNNANISN      4560
     GTVTVNAAID YTPTWTTASK TTAWGLTYGL DSHGMWTVLA NQQVMQSTDP LTWSKTALTL      4620
     YQSGNNYATS SIADYDRNGT GDLFITRDDY GTGYINGFTN NGDGTFSSAI QVTVGTLTWY      4680
     GSIVAFDKEG DGYLDFWIGD AGGPDSNTFL WNNAGTLVGN STTSNSGGSA TVGGAVTGYL      4740
     SLNEGSGVDL NNDGRIDLVQ HTYNLNNYYT LSSLINQGNG TFVWGQNTTN TFLSGAGSGA      4800
     MSSSVSMTWA DFDGDGDMDL FLPASQGRAN YGSLLFNTNG VLGCPVAVGA TATTYASQFS      4860
     LAVDWNHDGL MDIARIAQTG QSYLYTNVSN ASNWTQSALG GSQSGTTSGV AAMDYDWDGA      4920
     VDVLVSKQSG SVFLSRNTNT VSYGTSLHLR ITDPNGINVY YGNTVKLYNS AGVLVATQII      4980
     NPQSGMGVND TSALVNFYGL NAGETYNAVL IKSTGTTASN IDQTVNTSWG GLQATDATHA      5040
     YDLSAEAGTA SNNGKFVGTG YNDTFFATAG TDTYDGSGGW VYSSGTGTWL ANGGMDVVDF      5100
     RLSTVGVTAN LSSTAAQATG FNTSTFTNIE GISGSNFNDI LTGSSGDNQL EGRGGNDTLN      5160
     IGNGGHDTLL YKLLNASDAT GGNGSDVVNG FTVGTWEGTA DTDRIDIREL LQGSGYTGNG      5220
     KASYVNGVAT LDAQAGNIGD FVKVTQSGSD TIVQIDRDGT GGTFATTNVV TLTGVHTDLA      5280
     TLLANHQLMV V                                                           5291
//

If you have problems or comments...

PBIL Back to PBIL home page