(data stored in ACNUC7421 zone)

EMBL: BA000007.PE521

BA000007.PE521       Location/Qualifiers
FT   CDS             603985..605160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0544"
FT                   /product="membrane fusion protein of a transport system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33967"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33967"
FT                   /db_xref="GOA:Q8XD11"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD11"
FT                   /protein_id="BAB33967.1"
FT                   /translation="MNGQLQYNRGLTEPRLPRSALAVRVTAVMLLCFLGWAWYFQLDEV
FT                   TTGSGTVEPSGREQVVQSLEGGILYHLDVKVGDIVEQGQPLAQLNRTKTESDVQEAMSR
FT                   LYAALATSARLRAEVSNKPLVFPDELNKFPELIESETALYNTRRDGLNKATTGLTQGIS
FT                   LVNRELAMTQPLVKQGAASSVEVLRLQRQANELENKLSDVRTQYYVQAREELAKANAEV
FT                   ETQRSVIRGREDSLTRLNFTAPVRGIVQDIDVTTVGGVIAPGGKLMTIVPLDEQLLIEA
FT                   KISPRDVAFIHPGQKSLVKITAYDYSIYGGLPGEVAVISPDTVQDEVRRDVYYYRVYIR
FT                   TFSNHLENKSKQQFPIFPGMVATVDIRTGKKSVLDYLLKPFNKAQEALRER"
     MNGQLQYNRG LTEPRLPRSA LAVRVTAVML LCFLGWAWYF QLDEVTTGSG TVEPSGREQV        60
     VQSLEGGILY HLDVKVGDIV EQGQPLAQLN RTKTESDVQE AMSRLYAALA TSARLRAEVS       120
     NKPLVFPDEL NKFPELIESE TALYNTRRDG LNKATTGLTQ GISLVNRELA MTQPLVKQGA       180
     ASSVEVLRLQ RQANELENKL SDVRTQYYVQ AREELAKANA EVETQRSVIR GREDSLTRLN       240
     FTAPVRGIVQ DIDVTTVGGV IAPGGKLMTI VPLDEQLLIE AKISPRDVAF IHPGQKSLVK       300
     ITAYDYSIYG GLPGEVAVIS PDTVQDEVRR DVYYYRVYIR TFSNHLENKS KQQFPIFPGM       360
     VATVDIRTGK KSVLDYLLKP FNKAQEALRE R                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page