(data stored in ACNUC7421 zone)

EMBL: BA000007.PE525

BA000007.PE525       Location/Qualifiers
FT   CDS             607658..608020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33972"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33972"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC29"
FT                   /protein_id="BAB33972.1"
FT                   /translation="MNEFEKIFNEMNLDRALLPILFRSNRSTVWKYLSGDSTAPASAMS
FT                   LIMLLQLIQKRNPDLLAEWLTLSDFTIPPEVYLDQPDYWKGWVYTQHKVNKNVLEYLKK
FT                   HYPDEDQKSMSKGREE"
     MNEFEKIFNE MNLDRALLPI LFRSNRSTVW KYLSGDSTAP ASAMSLIMLL QLIQKRNPDL        60
     LAEWLTLSDF TIPPEVYLDQ PDYWKGWVYT QHKVNKNVLE YLKKHYPDED QKSMSKGREE       120
//

If you have problems or comments...

PBIL Back to PBIL home page