(data stored in ACNUC7421 zone)

EMBL: BA000007.PE572

BA000007.PE572       Location/Qualifiers
FT   CDS             complement(659140..662112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0600"
FT                   /product="bacteriophage N4 receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34023"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34023"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR8"
FT                   /protein_id="BAB34023.1"
FT                   /translation="MKENNLNRVIGWSGLLLTSLLSTSALADNIGTSAEELGLSDYRHF
FT                   VIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLL
FT                   EDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTLRCRSEVGQNALRL
FT                   AQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAER
FT                   RQWFDVLLAGQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENKPLFT
FT                   TDAQEKSWLYLLSKYSANPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLA
FT                   TLPANEMLEERYAVSVATRNKAEALRLARLLYQQESANLTRLDQLTWQLMQNEQSREAA
FT                   DLLLQRYPFQGDARISQTLMARLASLLESHPYLATPAKVAILSKPLPLAEQRQWQSQLP
FT                   GIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPNAWQHRA
FT                   VAYQAYQVEDYATALAARQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEQRGL
FT                   GSNALYWWLHAQRYIPGQPELALNDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDL
FT                   RAALELEPNNSNTQAALGYALWDSGDIAQSREMLEQAHKGLPDDPALIRQLAYVNQRLD
FT                   DMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRS
FT                   GAMSTANNNVGGAAPGKSYRSYGQLEAEYRIGRNMLLEGDLLSVYSRFFADTGENGVMM
FT                   PVKNPMSGTGLRWKPLRDQIFFLAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWH
FT                   PNGSGWFAQNLYLDAAQYIRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKG
FT                   TQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVH
FT                   W"
     MKENNLNRVI GWSGLLLTSL LSTSALADNI GTSAEELGLS DYRHFVIYPR LDKALKAQKN        60
     NDEATAIREF EYIHQQVPDN IPLTLYLAEA YRHFGHDDRA RLLLEDQLKR HPGDARLERS       120
     LAAIPVEVKS ITTVEELLAQ QKACDAAPTL RCRSEVGQNA LRLAQLPVAR AQLNDATFAA       180
     SPEGKTLRTD LLQRAIYLKQ WSQADTLYNE ARQQNTLSAA ERRQWFDVLL AGQLDDRILA       240
     LQSQGIFTDP QSYITYATAL AYRGEKARLQ HYLIENKPLF TTDAQEKSWL YLLSKYSANP       300
     VQALANYTVQ FADNRQYVVG ATLPVLLKEG QYDAAQKLLA TLPANEMLEE RYAVSVATRN       360
     KAEALRLARL LYQQESANLT RLDQLTWQLM QNEQSREAAD LLLQRYPFQG DARISQTLMA       420
     RLASLLESHP YLATPAKVAI LSKPLPLAEQ RQWQSQLPGI ADNCPAIVRL LGDMSPSYDA       480
     AAWNRLAKCY RDTLPGVALY AWLQAEQRQP NAWQHRAVAY QAYQVEDYAT ALAARQKISL       540
     HDMSNEDLLA AANTAQAAGN GAARDRWLQQ AEQRGLGSNA LYWWLHAQRY IPGQPELALN       600
     DLTRSINIAP SANAYVARAT IYRQRHNVPA AVSDLRAALE LEPNNSNTQA ALGYALWDSG       660
     DIAQSREMLE QAHKGLPDDP ALIRQLAYVN QRLDDMPATQ HYARLVIDDI DNQALITPLT       720
     PEQNQQRFNF RRLHEEVGRR WTFSFDSSIG LRSGAMSTAN NNVGGAAPGK SYRSYGQLEA       780
     EYRIGRNMLL EGDLLSVYSR FFADTGENGV MMPVKNPMSG TGLRWKPLRD QIFFLAVEQQ       840
     LPLNGQNGAS DTMLRASASF FNGGKYSDEW HPNGSGWFAQ NLYLDAAQYI RQDIQAWTAD       900
     YRVSWHQKVA NGQTIEPYAH VQDNGYRDKG TQGAQLGGVG VRWNIWTGET HYDAWPHKVS       960
     LGVEYQHTFK AINQRNGERN NAFLTIGVHW                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page