(data stored in ACNUC7421 zone)

EMBL: BA000007.PE574

BA000007.PE574       Location/Qualifiers
FT   CDS             complement(664602..665738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="ECs_0602"
FT                   /product="H repeat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34025"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34025"
FT                   /db_xref="GOA:Q8X565"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X565"
FT                   /protein_id="BAB34025.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDLGETHLNFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRRAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAMSEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKESEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVVNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVFAGSGLS"
     MELKKLMEHI SIIPDYRQAW KVEHKLSDIL LLTICAVISG AEGWEDIEDL GETHLNFLKQ        60
     YGDFENGIPV HDTIARVVSC ISPAKFHECF INWMRDCHSS DDKDVIAIDG KTLRHSYDKS       120
     RRRRAIHVIS AFSTMHSLVI GQIKTDEKSN EITAIPELLN MLDIKGKIIT TDAMGCQKDI       180
     AEKIQKQGGD YLFAVKGNQG RLNKAFEEKF PLKELNNPEH DSYAMSEKSH GREEIRLHIV       240
     CDVPDELIDF TFEWKGLKKL CVAVSFRSII AEQKKESEMT VRYYISSADL TAEKFATAIR       300
     NHWHVENKLH WRLDVVVNED DCKIRRGNAA ELFSGIRHIA INILTNDKVF KAGLRRKMRK       360
     AAMDRNYLAS VFAGSGLS                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page