(data stored in ACNUC7421 zone)

EMBL: BA000007.PE575

BA000007.PE575       Location/Qualifiers
FT   CDS             complement(666201..667535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0603"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34026"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028912"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR7"
FT                   /protein_id="BAB34026.1"
FT                   /translation="MTASGTGLGYGEGDESYGYDSCGYLKAQSAGGHRISEETDQYAGG
FT                   HRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRH
FT                   DASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDELYSVRHLVFNGFELISQQCSRV
FT                   RQPHPSVAPQWVTRTNHAVNDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYP
FT                   DPRGERDAEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRY
FT                   VPNPCGWVDPLGLAASSKISSLMDYIGDGRRVSGHTGFLDGVRLSRSQINNIAKEMEKL
FT                   GIKVIRKADKYLPPNARAAFDYGLRNIYLRKNATLYEVYHEVIHAKQFAKIGREAYEAL
FT                   GRLSREEHVLNEILKSKNLFNEAEIAHAIKYVEGLREKFMMGLIN"
     MTASGTGLGY GEGDESYGYD SCGYLKAQSA GGHRISEETD QYAGGHRLKQ AGNTQYDYDA        60
     AGRMVSRTRH RDGYRPETER FRWDSRDQLT GYCSAQGEQW EYRHDASGRR TEKRCDRKKI       120
     RFTYLWDGDS IAEIREYRDD ELYSVRHLVF NGFELISQQC SRVRQPHPSV APQWVTRTNH       180
     AVNDLTGRPL MLFNSEGKTV WRPGQTSLWG LALSLPADTD YPDPRGERDA EADPGLLYAG       240
     QWQDAESGLC YNRFRYYEPE TGMYLVSDPL GLQGGEQTYR YVPNPCGWVD PLGLAASSKI       300
     SSLMDYIGDG RRVSGHTGFL DGVRLSRSQI NNIAKEMEKL GIKVIRKADK YLPPNARAAF       360
     DYGLRNIYLR KNATLYEVYH EVIHAKQFAK IGREAYEALG RLSREEHVLN EILKSKNLFN       420
     EAEIAHAIKY VEGLREKFMM GLIN                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page