(data stored in ACNUC7421 zone)

EMBL: BA000007.PE576

BA000007.PE576       Location/Qualifiers
FT   CDS             complement(667704..668111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34027"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDX7"
FT                   /protein_id="BAB34027.1"
FT                   /translation="MKEIDLLYENIYQLLIKPYLLDLSSQSGKKIELNYTCKIKDAADE
FT                   IKGSMIFNDVDGKQKATCTIRVLILKTFHDGRYRFVIESVIYDLINNYSGFILTGRLFW
FT                   QGEGFGHELFPVTNKYNAWRWKNKKIIDISW"
     MKEIDLLYEN IYQLLIKPYL LDLSSQSGKK IELNYTCKIK DAADEIKGSM IFNDVDGKQK        60
     ATCTIRVLIL KTFHDGRYRF VIESVIYDLI NNYSGFILTG RLFWQGEGFG HELFPVTNKY       120
     NAWRWKNKKI IDISW                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page