(data stored in ACNUC7421 zone)

EMBL: BA000007.PE577

BA000007.PE577       Location/Qualifiers
FT   CDS             complement(668129..672979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0605"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34028"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34028"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCN2"
FT                   /protein_id="BAB34028.1"
FT                   /translation="MSEGPGGPQGATAGGTLAMRMLSQRAMAASQMKRAANDKAIAQML
FT                   ASKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPAL
FT                   MYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSKNVKINGKPAARAAVTLPPPPPP
FT                   GAIPEVPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTDSNAGFMDRVSAGASL
FT                   LFPAGPVLMEFATMVGGRGEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQP
FT                   AARKGDKLECSAAIVEGSPDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAG
FT                   LLGKLGNLAKLGKLGNLLGKSGKLLGAKLGALLGKTGNSLKSIANKVIRWVTDPVDPVT
FT                   GAYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDVIS
FT                   LGATLNFAFDGESDTAVNPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPV
FT                   TDDTSDDRLAHSPADRMYMLGGMSDTASNRITFERDTQYRITGVSHTDGIRLKLTYHAS
FT                   GYLKAIHRTDNGIQTLATYEQDARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDAQGR
FT                   CVTVTGAEGYYNATLDYGDGCTTVTDGKGIHRYYYDPDGNILREEAPDGSTTTYEWDEF
FT                   HHLLARHSPAGRVEKFEYNAAHGQLSRYTAADGADWQYCYDERGLLSNITAPAGQTWTQ
FT                   QCDERGLPVSLVSPQGEETRLAYTPQGLLSGIFRQDERRLGIEYDHHNWPETLTDVMGR
FT                   EHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAGTGAEGFRYDRHGNLLAYTD
FT                   GNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYLYILDNCGRV
FT                   TEERDWGGVVCRYRYDADGLCTARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKS
FT                   GRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEHTVIRCILPPEDERDRHP
FT                   DGSLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQP
FT                   VSQRAGLFPAEATWGGLLPSLLREYRYDSAGNVSGVTSREDYGRETHREYRLDRNGQVT
FT                   AVTASGTGLGYGEGDETYGYDSCGYLKAQSAGRHRISGETDQYAAGHRLKQAGNTQYDY
FT                   DAAGRMVSRTKHRDGYRPETERFRWDSRDQLTGYRSAQGEQWEYRHDASGRRTEKRCDR
FT                   KKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQPHPSVAPQWVT
FT                   RTNHAVSDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYPDPRGERDPEADPG
FT                   LLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPCGYIDPLGL
FT                   AICQLARWTKWGSEQSNISDVLNSLGNRALKYANGDWIKSEAAFNKYINMINKRLELTG
FT                   SKFRVEIQPAIKNGERVPATTNGPFKVNGKWTSGTHYTGGSKRLDAGIIDITSPTNQYG
FT                   LHPVIEGFDITLNKTKPSAVDIYSDVFGGIDINDFRL"
     MSEGPGGPQG ATAGGTLAMR MLSQRAMAAS QMKRAANDKA IAQMLASKKS GPPAARLGDE        60
     IQHKSFLGAL AGAVLGAIVT IAEGCLIMAA CATGPYALVL VPALMYASYK ASDYVEEKQN       120
     QLESWINSFC DTDGAINTGS KNVKINGKPA ARAAVTLPPP PPPGAIPEVP QGEPSWGDIA       180
     TDLLESAAEK AVPLAKAWGN AVITLTDSNA GFMDRVSAGA SLLFPAGPVL MEFATMVGGR       240
     GEIKKDVDFP EAGEDTALCD KENKPPRIAQ GSSNVFINNQ PAARKGDKLE CSAAIVEGSP       300
     DVFIGGEQVT YLDIQPEFPP WQRMILGGIT IASYLLPPAG LLGKLGNLAK LGKLGNLLGK       360
     SGKLLGAKLG ALLGKTGNSL KSIANKVIRW VTDPVDPVTG AYCDERTDFT LGQTLPLSFT       420
     RFHSSVLPLH GLTGVGWSDS WSEYAWVREQ GNRVDVISLG ATLNFAFDGE SDTAVNPYHA       480
     QYILRRRDDY LELFDRDALS SRFFYDAFPG MRLRHPVTDD TSDDRLAHSP ADRMYMLGGM       540
     SDTASNRITF ERDTQYRITG VSHTDGIRLK LTYHASGYLK AIHRTDNGIQ TLATYEQDAR       600
     LDYHLFYEYD AADRIIRWSD NDQTWSRFTY DAQGRCVTVT GAEGYYNATL DYGDGCTTVT       660
     DGKGIHRYYY DPDGNILREE APDGSTTTYE WDEFHHLLAR HSPAGRVEKF EYNAAHGQLS       720
     RYTAADGADW QYCYDERGLL SNITAPAGQT WTQQCDERGL PVSLVSPQGE ETRLAYTPQG       780
     LLSGIFRQDE RRLGIEYDHH NWPETLTDVM GREHHTEYSG HDLPVKMRGP GGQSVRLQWQ       840
     QHHKLSGLER AGTGAEGFRY DRHGNLLAYT DGNGVVWTME YGPFDLPVAR TDGEGHRWQY       900
     RYDKDTLQLT EVINPQGESY LYILDNCGRV TEERDWGGVV CRYRYDADGL CTARVNGLEE       960
     TILYSRDAAG RLAEVITPEG KTQYAYDKSG RLTGIFSPDG TSQRTGYDER GRVNVTTQGR      1020
     RAIEYHYPDE HTVIRCILPP EDERDRHPDG SLLKTTYRYN AAGELTEVIL PGDETLTFSR      1080
     DEAGREVLRH SNRGFACEQG WNAAGQPVSQ RAGLFPAEAT WGGLLPSLLR EYRYDSAGNV      1140
     SGVTSREDYG RETHREYRLD RNGQVTAVTA SGTGLGYGEG DETYGYDSCG YLKAQSAGRH      1200
     RISGETDQYA AGHRLKQAGN TQYDYDAAGR MVSRTKHRDG YRPETERFRW DSRDQLTGYR      1260
     SAQGEQWEYR HDASGRRTEK RCDRKKIRFT YLWDGDSIAE IREYRDDKLY SVRHLVFNGF      1320
     ELISQQFSRV RQPHPSVAPQ WVTRTNHAVS DLTGRPLMLF NSEGKTVWRP GQTSLWGLAL      1380
     SLPADTDYPD PRGERDPEAD PGLLYAGQWQ DAESGLCYNR FRYYEPETGM YLVSDPLGLQ      1440
     GGEQTYRYVP NPCGYIDPLG LAICQLARWT KWGSEQSNIS DVLNSLGNRA LKYANGDWIK      1500
     SEAAFNKYIN MINKRLELTG SKFRVEIQPA IKNGERVPAT TNGPFKVNGK WTSGTHYTGG      1560
     SKRLDAGIID ITSPTNQYGL HPVIEGFDIT LNKTKPSAVD IYSDVFGGID INDFRL          1616
//

If you have problems or comments...

PBIL Back to PBIL home page