(data stored in ACNUC7421 zone)

EMBL: BA000007.PE578

BA000007.PE578       Location/Qualifiers
FT   CDS             complement(672999..673460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34029"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34029"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JG68"
FT                   /protein_id="BAB34029.1"
FT                   /translation="MQFTFNEGHIQLPSQWQDQSMQVLVSTDNSGINLVITREPVSQGT
FT                   LTPELYQETLALYQGKLDGYTEHACREITLAEAPAWLLDYSWNGPEDEGNQGRISQIAV
FT                   FQRRGDTLLTFTFSTSLSLKNSQKTMLLEVIKSFTPLPPENDIQKDQPR"
     MQFTFNEGHI QLPSQWQDQS MQVLVSTDNS GINLVITREP VSQGTLTPEL YQETLALYQG        60
     KLDGYTEHAC REITLAEAPA WLLDYSWNGP EDEGNQGRIS QIAVFQRRGD TLLTFTFSTS       120
     LSLKNSQKTM LLEVIKSFTP LPPENDIQKD QPR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page