(data stored in ACNUC7421 zone)

EMBL: BA000007.PE579

BA000007.PE579       Location/Qualifiers
FT   CDS             complement(673488..675389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0607"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34030"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34030"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="PDB:3WIT"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBY5"
FT                   /protein_id="BAB34030.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLTQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVHPPLWRAGL
FT                   RQNFRIFQNEDIKSILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAYKSTDQSLVLCDTVRHLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMEGWR
FT                   NNAETARGMSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGAGTA
FT                   LENHFAVIPADRTWRPQPRLKPLVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNP
FT                   ADQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYMGSGFNELKFDDATGREQVYIHAQKNMDTEVLNDRTTTVKHDH
FT                   RETVKNDQTVTIQEGNRLLTVEKGHKITGVLKGSLSEDVFQDRGTIAGSVHVDAVNNGG
FT                   EGNGIQAYTAIKEIMLAVEESKIALTPDGIQLQVGESTVIRLSKDGITIVGGSVFIN"
     MSTGLRFTLE VDGLPPDAFA VVSFHLTQSL SSLFSLDLSL VSQQFLSLEF AQVLDKMAYL        60
     TIWQGDDVQR RVKGVVTWFE LGENDKNQML YSMKVHPPLW RAGLRQNFRI FQNEDIKSIL       120
     GTILQENGVT EWSPLFSEPH PSREFCVQYG ETDYDFLCRM AAEEGIFFYE EHAYKSTDQS       180
     LVLCDTVRHL PESFEIPWNP NTRTEVSTLC ISQFRYSAQI RPSSVVTKDY TFKRPGWAGR       240
     FDQEGQHQDY QRTQYEVYDY PGRFKGAHGQ NFARWQMEGW RNNAETARGM SRSPEIWPGR       300
     RIVLTGHPQA NLNREWQVVA SELHGEQPQA VPGRRGAGTA LENHFAVIPA DRTWRPQPRL       360
     KPLVDGPQSA VVTGPEGEEI FCDEHGRVRV KFNWDRYNPA DQDSSCWIRV AQAWAGTGFG       420
     NLAIPRVGQE VIVDFLNGDP DQPIIMGRTY HQENRTPGSL PGTKTQMTIR SKTYMGSGFN       480
     ELKFDDATGR EQVYIHAQKN MDTEVLNDRT TTVKHDHRET VKNDQTVTIQ EGNRLLTVEK       540
     GHKITGVLKG SLSEDVFQDR GTIAGSVHVD AVNNGGEGNG IQAYTAIKEI MLAVEESKIA       600
     LTPDGIQLQV GESTVIRLSK DGITIVGGSV FIN                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page