(data stored in ACNUC7421 zone)

EMBL: BA000007.PE593

BA000007.PE593       Location/Qualifiers
FT   CDS             690842..690994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECs_0621"
FT                   /product="regulatory peptide MokC whose translation enables
FT                   hok (gef) expression"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34044"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34044"
FT                   /db_xref="GOA:Q8XBW9"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBW9"
FT                   /protein_id="BAB34044.2"
FT                   /translation="MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
     MLTKYALVAV IVLCLTVLGF TLLVGDSLCE FTVKERNIEF KAVLAYEPKK                   50
//

If you have problems or comments...

PBIL Back to PBIL home page