(data stored in ACNUC7421 zone)

EMBL: BA000007.PHOR

BA000007.PHOR        Location/Qualifiers
FT   CDS             479871..481166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ECs_0450"
FT                   /product="two-component system sensor histidine kinase
FT                   PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33873"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33873"
FT                   /db_xref="GOA:Q8XE99"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE99"
FT                   /protein_id="BAB33873.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSVISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIVKNSD"
     MLERLSWKRL VLELLLCCLP AFILGAFFGY LPWFLLASVT GLLIWHFWNL LRLSWWLWVD        60
     RSMTPPPGRG SWEPLLYGLH QMQLRNKKRR RELGNLIKRF RSGAESLPDA VVLTTEEGGI       120
     FWCNGLAQQI LGLRWPEDNG QNILNLLRYP EFTQYLKTRD FSRPLNLVLN TGRHLEIRVM       180
     PYTHKQLLMV ARDVTQMHQL EGARRNFFAN VSHELRTPLT VLQGYLEMMD EQPLEGAVRE       240
     KALHTMREQT QRMEGLVKQL LTLSKIEAAP TQLLNEKVDV PMMLRVVERE AQTLSQKKQT       300
     FTFEIDNGLK VSGNEDQLRS VISNLVYNAV NHTPEGTHIT VRWQRVPHGA EFSVEDNGPG       360
     IAPEHIPRLT ERFYRVDKAR SRQTGGSGLG LAIVKHAVNH HESRLNIEST VGKGTRFSFV       420
     IPERLIVKNS D                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page