(data stored in ACNUC7421 zone)

EMBL: BA000007.PRFH

BA000007.PRFH        Location/Qualifiers
FT   CDS             291590..292090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="ECs_0263"
FT                   /product="peptide chain release factor RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33686"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33686"
FT                   /db_xref="GOA:Q8X7N9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7N9"
FT                   /protein_id="BAB33686.1"
FT                   /translation="MLETETGRYSDTLRSALISLDGDNAWALSESWCGTIQWICLSPYR
FT                   PHHGRKNWFLGIGRFTADEQEQSDAIRYETLRPSGPGGQHVNKTDSAVRATHLATGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
     MLETETGRYS DTLRSALISL DGDNAWALSE SWCGTIQWIC LSPYRPHHGR KNWFLGIGRF        60
     TADEQEQSDA IRYETLRPSG PGGQHVNKTD SAVRATHLAT GISVKVQSER SQHANKRLAR       120
     LLIAWKLEQQ QQENSAVLKS QRRMFHHQIE RGNPRRTFTG MAFIEG                      166
//

If you have problems or comments...

PBIL Back to PBIL home page