(data stored in ACNUC7421 zone)

EMBL: BA000007.PRIC

BA000007.PRIC        Location/Qualifiers
FT   CDS             complement(556181..556708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECs_0520"
FT                   /product="primosomal replication protein PriC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33943"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33943"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCK2"
FT                   /protein_id="BAB33943.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFNRHLFQTRATT
FT                   LQACLDKAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPQ
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     MKTALLLEKL EGQLATLRQR CAPVSQFATL SARFNRHLFQ TRATTLQACL DKAGDNLAAL        60
     RHAVEQQQLP QVAWLAEHLA AQLEAIAREA TAWSLREWDS APPQIARWQR KRIQHQDFER       120
     RLREMVAERR ARLARVTDLV EQQTLHREVE AYEARLARCR HALEKIENRL ARLTR            175
//

If you have problems or comments...

PBIL Back to PBIL home page