(data stored in ACNUC7421 zone)

EMBL: BA000007.PSIF

BA000007.PSIF        Location/Qualifiers
FT   CDS             463061..463381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECs_0434"
FT                   /product="phosphate starvation-inducible protein PsiF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33857"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33857"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEB3"
FT                   /protein_id="BAB33857.2"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     MKITLLVTLL FGLVFLTTVG AAERTLTPQQ QRMTSCNQQA TAQALKGDAR KTYMSDCLKN        60
     SKSAPGEKSL TPQQQKMREC NNQATQQSLK GDDRNKFMSA CLKKAA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page