(data stored in ACNUC7421 zone)

EMBL: BA000007.RCLC

BA000007.RCLC        Location/Qualifiers
FT   CDS             complement(360441..361034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclC"
FT                   /locus_tag="ECs_0340"
FT                   /product="reactive chlorine species stress resistance inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33762"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33762"
FT                   /db_xref="GOA:Q8X6F8"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6F8"
FT                   /protein_id="BAB33762.1"
FT                   /translation="MEKYLHLLSRGDKIGLALIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQSANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQGSNESSSTLKTEY"
     MEKYLHLLSR GDKIGLALIR LSIAIVFMWI GLLKFVPYEA DSITPFVANS PLMSFFYEHP        60
     EDYKQYLTHE GEYKPEARAW QSANNTYGFS NGLGVVEVII ALLVLANPVN RWLGLLGGLM       120
     AFTTPLVTLS FLITTPEAWV PALGDAHHGF PYLSGAGRLV LKDTLMLAGA VMIMADSARE       180
     ILKQGSNESS STLKTEY                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page