(data stored in ACNUC7421 zone)

EMBL: BA000007.RDGC

BA000007.RDGC        Location/Qualifiers
FT   CDS             complement(471195..472172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECs_0444"
FT                   /product="recombination-associated protein rdgC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33868"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33868"
FT                   /db_xref="GOA:Q8XEA0"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA0"
FT                   /protein_id="BAB33868.2"
FT                   /translation="MQGRRQFVIMPAKFNDKAVEIIMLWFKNLMVYRLSREISLRAEEM
FT                   EKQLASMAFTPCGSQDMAKMGWVPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQ
FT                   ALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDC
FT                   ASAKKAEDTLALLRKSLGSLPVVPLSMANPIELTLTEWVRSGSAAQGFQLLDEAELKSL
FT                   LEDGGVIRAKKQDLTSEEITNHIEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDEL
FT                   RDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLGGEAQR"
     MQGRRQFVIM PAKFNDKAVE IIMLWFKNLM VYRLSREISL RAEEMEKQLA SMAFTPCGSQ        60
     DMAKMGWVPP MGSHSDALTH VANGQIVICA RKEEKILPSP VIKQALEAKI AKLEAEQARK       120
     LKKTEKDSLK DEVLHSLLPR AFSRFSQTMM WIDTVNGLIM VDCASAKKAE DTLALLRKSL       180
     GSLPVVPLSM ANPIELTLTE WVRSGSAAQG FQLLDEAELK SLLEDGGVIR AKKQDLTSEE       240
     ITNHIEAGKV VTKLALDWQQ RIQFVMCDDG SLKRLKFCDE LRDQNEDIDR EDFAQRFDAD       300
     FILMTGELAA LIQNLIEGLG GEAQR                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page