(data stored in ACNUC7421 zone)

EMBL: BA000007.RHSC

BA000007.RHSC        Location/Qualifiers
FT   CDS             267079..271293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsC"
FT                   /locus_tag="ECs_0237"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33660"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33660"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XED9"
FT                   /protein_id="BAB33660.2"
FT                   /translation="MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITY
FT                   ANPVNPVLGAKVLPGETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRL
FT                   QIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLP
FT                   EDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAF
FT                   HRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLV
FT                   FPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGT
FT                   QVRGFAYDAEHAGRMVAHHYAGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTIT
FT                   DSLNRREVLYTEGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMA
FT                   SGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRY
FT                   SYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREE
FT                   GISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVST
FT                   TQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKL
FT                   TQSEDEGLVTLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGY
FT                   DDKGRLTGERQTVENPETGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLA
FT                   GMKLGGTPLVEYMRDRLHRETARSFGGEAYELATAWNTSGQLRSRHLNLPQLDRDYDWN
FT                   DNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPELHPDS
FT                   TLTAWPDNRIAEDAHYVYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFH
FT                   TRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTV
FT                   QTQQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGR
FT                   LERELRQGSVSEESQQWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPLALISP
FT                   EGETAWQGEYDEWGNLLGETSAQHLQQSLRLPGQQYDEESGLYYNRNRYYDPLQGRYIT
FT                   QDPIGLEGGWNLYQYPLNPIEHIDPLGLALDLNYYSPSDPIYKGSLNVREFPTGFTVGG
FT                   HGSPTSMSDDRIKKGSDLTIKQLASDIRANPKYHEGMPVVLFSCETGKGKNSFAQKLAN
FT                   ELDATVIAPDEIIWIWPDGNYAIMGQTARITIGGKDNGVFELVPDEKQPGDFHKFTPTG
FT                   SK"
     MGGKPAARQG DMTRKGLDIV QGSAGVLIGA PTGVACSVCP GGITYANPVN PVLGAKVLPG        60
     ETDLALPGPL PFILSRAYSS YRTRTPAPVG VFGPGWKAPF DIRLQIRDEG LILNDNGGRS       120
     IHFEPLFPGE ISYSRSESFW LARGGVAEQH SSQPLSALWQ VLPEDVRLSP HMYLATNSLQ       180
     GPWWILNWPE RVPGADEVLP PEPPAYRVLT GVVDGFGRTL AFHRAAEGDV AGAVTGVTDG       240
     AGRRFHLVLT TQAQRAEVFR KQRATSLSSP AGPRSASSSL VFPDTLPAGT EYGADNGIRL       300
     EAVWLTHDPA YPDELPAAPL ARYTYTASGE LRAVYDRSGT QVRGFAYDAE HAGRMVAHHY       360
     AGRPESRYRY DDTGRVTELV NPEGLDYRFE YGQDRVTITD SLNRREVLYT EGEGGLKRVV       420
     KKEHADGSIT RSEYDEAGRL KAQTDAAGRR TEYSLHMASG AVTAVTGPDG RTVRYGYNSQ       480
     RQVTSVTYPD GLRSSREYDE KGRLAAETSR SGETTRYSYD DPASELPTGI QDATGSTKQM       540
     AWSRYGQLLT FTDCSGYTTR YEYDRYGQQI AVHREEGIST YSSYNPRGQL VSQKDAQGRE       600
     TRYEYSAAGD LTAIVAPDGS RSEIQYDAWG KAVSTTQGGL TRSMGYDAAG RITVLTNENG       660
     SQSTFRYDPV DRLTEQRGFD GRTQRYHYDL TGKLTQSEDE GLVTLWHYDA SDRITHRTVN       720
     GDPAEQWQYD EHGWLTTLSH TSEGHRVSVH YGYDDKGRLT GERQTVENPE TGEMLWEHET       780
     GHAYSEQGLA TRQEPDGLPP VEWLTYGSGY LAGMKLGGTP LVEYMRDRLH RETARSFGGE       840
     AYELATAWNT SGQLRSRHLN LPQLDRDYDW NDNGQLIRIS GPQESREYRY SDTGRLTGVH       900
     TTAANLDIDI PYATDPAGNR LPDPELHPDS TLTAWPDNRI AEDAHYVYRY DEYGRLAEKT       960
     DRIPEGVIRM HDERTHHYHY DSQHRLVFHT RIQHGEPQVE SRYLYDPLGR RTGKRVWRRE      1020
     RDLTGWMSLS RKPEETWYGW DGDRLTTVQT QQTRIQTVYQ PGSFTPLLRI ETENGEQAKA      1080
     RHRSLAEVLQ EDTGVTLPAE LAVMLGRLER ELRQGSVSEE SQQWLAQCGL TAEQMAAQLE      1140
     AEYIPERKLH LYHCDHRGLP LALISPEGET AWQGEYDEWG NLLGETSAQH LQQSLRLPGQ      1200
     QYDEESGLYY NRNRYYDPLQ GRYITQDPIG LEGGWNLYQY PLNPIEHIDP LGLALDLNYY      1260
     SPSDPIYKGS LNVREFPTGF TVGGHGSPTS MSDDRIKKGS DLTIKQLASD IRANPKYHEG      1320
     MPVVLFSCET GKGKNSFAQK LANELDATVI APDEIIWIWP DGNYAIMGQT ARITIGGKDN      1380
     GVFELVPDEK QPGDFHKFTP TGSK                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page