(data stored in ACNUC7421 zone)

EMBL: BA000007.RHSD

BA000007.RHSD        Location/Qualifiers
FT   CDS             617058..621254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsD"
FT                   /locus_tag="ECs_0560"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33983"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33983"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEI5"
FT                   /protein_id="BAB33983.2"
FT                   /translation="MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTS
FT                   GNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTRTPAPVGIFGPGWKAPSDIRL
FT                   QLRDDALVLNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALP
FT                   PDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGMADRFGRTLTY
FT                   RREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARKQHTASLSSPDTPRPLSDSAF
FT                   PDTLPGTEYGPDRGIRLSAVWLTHDPAYPESLPAAPLVRYTYTEAGELLAVYDRSNTQV
FT                   RAFTYDAQHPGRMVGHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYHYQYEQDRITVTDS
FT                   LNRREVLHTEGGAGLKRVVKKELADGSVTHSGYDAAGRLTAQTDAAGRRTEYGLNVVSG
FT                   DITDITTPDGRETKFYYNDGNQLTAVVSPDGLESRRAYDEPGRLVSETSRSGETVRYRY
FT                   DDAYSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGI
FT                   SLYRRYDNRGRLISVKDAQGHETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQ
FT                   GGLTRSMEYDLAGRITTLTNENGSRSEFTYDALDRLVQQRGFDGRTQRYHYDLTGKLTQ
FT                   SEDEGLVTLWHYDESDRLTHRTVNGEPAEQWQYDEHGWLTEISHLSEGHQVAVHYGYDD
FT                   KGRLAGERQTVHNPETGELLWQHETEHAYNEQGLANRVTPDSLPRVEWLTYGSGYLAGM
FT                   KLGGTPLVEFTRDRLHRETVRSFGNNAYELTSTYTPAGHLQSQRLNSQVYDRDYDWNDN
FT                   GDLVRISGPRQTREYGYSATGRLESVRTLASDLDIRIPYATDPAGNRLPDPELHPDSTL
FT                   TAWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTR
FT                   IQHGEPLVESRYLYDPLGRRTGKRVWRRGRDLTGWMSLSRKPEVTWYGWDGDRLTTVQT
FT                   DTTRIQTVYEPGSFAPLIRIETDNGEREKAQRRSLAEKLQQEGSEDGHGVVFPAELVRL
FT                   LDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVEPEYTPARKVHLYHCDHRGLPLAL
FT                   ISEDGNTAWSGEYDEWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNRNRYYDPLQGR
FT                   YITQDPIGLEGGWSLYAYPLNPVNGIDPLGLSPADVALIRRKDQLNHQRAWDILSDTYE
FT                   DMKRLNLGGTDQFFHCMAFCRVSKLNDAGVSRSAKGLGYEKEIRDYGLNLFGMYGRKVK
FT                   LSHSEMIEDNKKDLAVNDHGLTCPSTTDCSDRCSDYINPEHKETIKALQDAGYLK"
     MSGKPAARQG DMTQYGGPIV QGSAGVRIGA PTGVACSVCP GGMTSGNPVN PLLGAKVLPG        60
     ETDLALPGPL PFILSRTYSS YRTRTPAPVG IFGPGWKAPS DIRLQLRDDA LVLNDNGGRS       120
     IHFEPLLPGE AVYSRSESMW LVRGGKAAQP DGHTLARLWG ALPPDIRLSP HLYLATNSAQ       180
     GPWWILGWSE RVPGAEDVLP APLPPYRVLT GMADRFGRTL TYRREAAGDL AGEITGVTDG       240
     AGREFRLVLT TQAQRAEEAR KQHTASLSSP DTPRPLSDSA FPDTLPGTEY GPDRGIRLSA       300
     VWLTHDPAYP ESLPAAPLVR YTYTEAGELL AVYDRSNTQV RAFTYDAQHP GRMVGHRYAG       360
     RPEMRYRYDD AGRVVEQLNP AGLSYHYQYE QDRITVTDSL NRREVLHTEG GAGLKRVVKK       420
     ELADGSVTHS GYDAAGRLTA QTDAAGRRTE YGLNVVSGDI TDITTPDGRE TKFYYNDGNQ       480
     LTAVVSPDGL ESRRAYDEPG RLVSETSRSG ETVRYRYDDA YSELPATTTD ATGSTRQMTW       540
     SRYGQLLAFT DCSGYQTRYE YDRFGQMTAV HREEGISLYR RYDNRGRLIS VKDAQGHETR       600
     YEYNAAGDLT AVITPDGNRS ETQYDAWGKA VSTTQGGLTR SMEYDLAGRI TTLTNENGSR       660
     SEFTYDALDR LVQQRGFDGR TQRYHYDLTG KLTQSEDEGL VTLWHYDESD RLTHRTVNGE       720
     PAEQWQYDEH GWLTEISHLS EGHQVAVHYG YDDKGRLAGE RQTVHNPETG ELLWQHETEH       780
     AYNEQGLANR VTPDSLPRVE WLTYGSGYLA GMKLGGTPLV EFTRDRLHRE TVRSFGNNAY       840
     ELTSTYTPAG HLQSQRLNSQ VYDRDYDWND NGDLVRISGP RQTREYGYSA TGRLESVRTL       900
     ASDLDIRIPY ATDPAGNRLP DPELHPDSTL TAWPDNRIAE DAHYVYRHDE YGRLTEKTDR       960
     IPAGVIRTDD ERTHHYHYDS QHRLVFYTRI QHGEPLVESR YLYDPLGRRT GKRVWRRGRD      1020
     LTGWMSLSRK PEVTWYGWDG DRLTTVQTDT TRIQTVYEPG SFAPLIRIET DNGEREKAQR      1080
     RSLAEKLQQE GSEDGHGVVF PAELVRLLDR LEEEIRADRV SSESRAWLAQ CGLTVEQLAR      1140
     QVEPEYTPAR KVHLYHCDHR GLPLALISED GNTAWSGEYD EWGNQLNEEN PHHLHQPYRL      1200
     PGQQYDKESG LYYNRNRYYD PLQGRYITQD PIGLEGGWSL YAYPLNPVNG IDPLGLSPAD      1260
     VALIRRKDQL NHQRAWDILS DTYEDMKRLN LGGTDQFFHC MAFCRVSKLN DAGVSRSAKG      1320
     LGYEKEIRDY GLNLFGMYGR KVKLSHSEMI EDNKKDLAVN DHGLTCPSTT DCSDRCSDYI      1380
     NPEHKETIKA LQDAGYLK                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page