(data stored in ACNUC7421 zone)

EMBL: BA000007.RIBD

BA000007.RIBD        Location/Qualifiers
FT   CDS             497711..498814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ECs_0467"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33890"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33890"
FT                   /db_xref="GOA:Q8XE88"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE88"
FT                   /protein_id="BAB33890.1"
FT                   /translation="MQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWSELDVQTQALYPQH
FT                   HLRQPVRIVIDSQNRVTPEHHIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDL
FT                   VVLMMQLGKQQINSIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLE
FT                   KLADAPQFKFKEIRHVGPDVCLHLVGA"
     MQDEYYMARA LKLAQRGRFT THPNPNVGCV IVKDGEIVGE GYHQRAGEPH AEVHALRMAG        60
     EKAKGATAYV TLEPCSHHGR TPPCCDALIA AGVARVVAAM QDPNPQVAGR GLYRLQQAGI       120
     DVSHGLMMSE AEQLNKGFLK RMRTGFPYIQ LKLGASLDGR TAMASGESQW ITSPQARRDV       180
     QRLRAQSHAI LTSSATVLAD DPALTVRWSE LDVQTQALYP QHHLRQPVRI VIDSQNRVTP       240
     EHHIVQQPGE TWFARTQEDS REWPETVRTL LIPEHKGHLD LVVLMMQLGK QQINSIWVEA       300
     GPTLAGALLQ AGLVDELIVY IAPKLLGSDA RGLCTLPGLE KLADAPQFKF KEIRHVGPDV       360
     CLHLVGA                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page