(data stored in ACNUC7421 zone)

EMBL: BA000007.RNK

BA000007.RNK         Location/Qualifiers
FT   CDS             complement(724912..725322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ECs_0649"
FT                   /product="nucleoside diphosphate kinase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34072"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34072"
FT                   /db_xref="GOA:P0AFW6"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFW6"
FT                   /protein_id="BAB34072.1"
FT                   /translation="MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCS
FT                   PEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVG
FT                   DSIHWELPGGVATHLEVLELEYQPEAAGDYLL"
     MSRPTIIIND LDAERIDILL EQPAYAGLPI ADALNAELDR AQMCSPEEMP HDVVTMNSRV        60
     KFRNLSDGEV RVRTLVYPAK MTDSNTQLSV MAPVGAALLG LRVGDSIHWE LPGGVATHLE       120
     VLELEYQPEA AGDYLL                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page