(data stored in ACNUC7421 zone)

EMBL: BA000007.RPSB

BA000007.RPSB        Location/Qualifiers
FT   CDS             193361..194086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ECs_0171"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33594"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33594"
FT                   /db_xref="GOA:P0A7V2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7V2"
FT                   /protein_id="BAB33594.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
     MATVSMRDML KAGVHFGHQT RYWNPKMKPF IFGARNKVHI INLEKTVPMF NEALAELNKI        60
     ASRKGKILFV GTKRAASEAV KDAALSCDQF FVNHRWLGGM LTNWKTVRQS IKRLKDLETQ       120
     SQDGTFDKLT KKEALMRTRE LEKLENSLGG IKDMGGLPDA LFVIDADHEH IAIKEANNLG       180
     IPVFAIVDTN SDPDGVDFVI PGNDDAIRAV TLYLGAVAAT VREGRSQDLA SQAEESFVEA       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page