(data stored in ACNUC7421 zone)

EMBL: BA000007.RPST

BA000007.RPST        Location/Qualifiers
FT   CDS             complement(25221..25484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECs_0026"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33449"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33449"
FT                   /db_xref="GOA:P0A7U9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7U9"
FT                   /protein_id="BAB33449.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     MANIKSAKKR AIQSEKARKH NASRRSMMRT FIKKVYAAIE AGDKAAAQKA FNEMQPIVDR        60
     QAAKGLIHKN KAARHKANLT AQINKLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page