(data stored in ACNUC7421 zone)

EMBL: BA000007.SECD

BA000007.SECD        Location/Qualifiers
FT   CDS             491310..493124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ECs_0459"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33882"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33882"
FT                   /db_xref="GOA:P0AG91"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG91"
FT                   /protein_id="BAB33882.2"
FT                   /translation="MLIVVIVIGLLYALPNLFGEDPAVQITGARGVAASEQTLIQVQKT
FT                   LQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALNLAPATPRWLAA
FT                   IHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNY
FT                   GLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEAREYAVQQNINI
FT                   LRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAA
FT                   AASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGN
FT                   IMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITG
FT                   INNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACLAGLLVSILFMI
FT                   IFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERI
FT                   KEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVA
FT                   TSMFTAIVGTRAIVNLLYGGKRVKKLSI"
     MLIVVIVIGL LYALPNLFGE DPAVQITGAR GVAASEQTLI QVQKTLQEEK ITAKSVALEE        60
     GAILARFDST DTQLRAREAL MGVMGDKYVV ALNLAPATPR WLAAIHAEPM KLGLDLRGGV       120
     HFLMEVDMDT ALGKLQEQNI DSLRSDLREK GIPYTTVRKE NNYGLSITFR DAKARDEAIA       180
     YLSKRHPDLV ISSQGSNQLR AVMSDARLSE AREYAVQQNI NILRNRVNQL GVAEPVVQRQ       240
     GADRIVVELP GIQDTARAKE ILGATATLEF RLVNTNVDQA AAASGRVPGD SEVKQTREGQ       300
     PVVLYKRVIL TGDHITDSTS SQDEYNQPQV NISLDSAGGN IMSNFTKDNI GKPMATLFVE       360
     YKDSGKKDAN GRAVLVKQEE VINIANIQSR LGNSFRITGI NNPNEARQLS LLLRAGALIA       420
     PIQIVEERTI GPTLGMQNIE QGLEACLAGL LVSILFMIIF YKKFGLIATS ALIANLILIV       480
     GIMSLLPGAT LSMPGIAGIV LTLAVAVDAN VLINERIKEE LSNGRTVQQA IDEGYRGAFS       540
     SIFDANITTL IKVIILYAVG TGAIKGFAIT TGIGVATSMF TAIVGTRAIV NLLYGGKRVK       600
     KLSI                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page