(data stored in ACNUC7421 zone)

EMBL: BA000007.SECF

BA000007.SECF        Location/Qualifiers
FT   CDS             493135..494106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ECs_0460"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33883"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33883"
FT                   /db_xref="GOA:P0AG95"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG95"
FT                   /protein_id="BAB33883.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
     MAQEYTVEQL NHGRKVYDFM RWDYWAFGIS GLLLIAAIVI MGVRGFNWGL DFTGGTVIEI        60
     TLEKPAEIDV MRDALQKAGF EEPMLQNFGS SHDIMVRMPP AEGETGGQVL GSQVLKVINE       120
     STNQNAAVKR IEFVGPSVGA DLAQTGAMAL MAALLSILVY VGFRFEWRLA AGVVIALAHD       180
     VIITLGILSL FHIEIDLTIV ASLMSVIGYS LNDSIVVSDR IRENFRKIRR GTPYEIFNVS       240
     LTQTLHRTLI TSGTTLMVIL MLYLFGGPVL EGFSLTMLIG VSIGTASSIY VASALALKLG       300
     MKREHMLQQK VEKEGADQPS ILP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page