(data stored in ACNUC7421 zone)

EMBL: BA000007.SFMA

BA000007.SFMA        Location/Qualifiers
FT   CDS             650665..651207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="ECs_0592"
FT                   /product="type-1 fimbrial protein subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34015"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34015"
FT                   /db_xref="GOA:P0ABW6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABW6"
FT                   /protein_id="BAB34015.2"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNT
FT                   DSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNL
FT                   LAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTS
FT                   ASAGQANADATFIMRYE"
     MKLRFISSAL AAALFAATGS YAAVVDGGTI HFEGELVNAA CSVNTDSADQ VVTLGQYRTD        60
     IFNAVGNTSA LIPFTIQLND CDPVVAANAA VAFSGQADAI NDNLLAIASS TNTTTATGVG       120
     IEILDNTSAI LKPDGNSFST NQNLIPGTNV LHFSARYKGT GTSASAGQAN ADATFIMRYE       180
//

If you have problems or comments...

PBIL Back to PBIL home page