(data stored in ACNUC7421 zone)

EMBL: BA000007.SFMF

BA000007.SFMF        Location/Qualifiers
FT   CDS             655790..656305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECs_0596"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34019"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34019"
FT                   /db_xref="GOA:Q8XCR9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR9"
FT                   /protein_id="BAB34019.1"
FT                   /translation="MRRVFFSCFCGLLWSSSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALLPFSLRLEGCPPGSVAILFTGTPASDANLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     MRRVFFSCFC GLLWSSSGWA ADPLGTININ LHGNVVDFSC TVNTADIDKT VDLGRWPTTQ        60
     LLNAGDTTAL LPFSLRLEGC PPGSVAILFT GTPASDANLL ALDDPAMAQT VAIELRNSDR       120
     SRLALGEASP TEEVDANGNV TLNFFANYRA LASGVRPGVA KADAIFMINY N                171
//

If you have problems or comments...

PBIL Back to PBIL home page