(data stored in ACNUC7421 zone)

EMBL: BA000007.SFMH

BA000007.SFMH        Location/Qualifiers
FT   CDS             654772..655779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECs_0595"
FT                   /product="fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34018"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34018"
FT                   /db_xref="GOA:Q8XCS0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCS0"
FT                   /protein_id="BAB34018.2"
FT                   /translation="MKIICRLLLAMACLCLANISWATVCANSTGVAEDEHYDLSNVFNS
FT                   TNNQPGQIVVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLNDYL
FT                   LGAMSLVDSVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIP
FT                   RQVMFTVYVTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAA
FT                   GPGNRPAGVMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQND
FT                   TPITPNDLNSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
     MKIICRLLLA MACLCLANIS WATVCANSTG VAEDEHYDLS NVFNSTNNQP GQIVVLPEKS        60
     GWVGVSAICP PGTLVNYTYR SYVTNFIVQE TIDNYKYMQL NDYLLGAMSL VDSVMDIQFP       120
     PQNYIRMGTD PNVSQNLPFG VMDSRLIFRL KVIRPFINMV EIPRQVMFTV YVTSTPYDPL       180
     VTPVYTISFG GRVEVPQNCE LNAGQIVEFD FGDIGASLFS AAGPGNRPAG VMPQTKSIAV       240
     KCTNVAAQAY LTMRLEASAV SGQAMVSDNQ DLGFIVADQN DTPITPNDLN SVIPFRLDAA       300
     AAANVTLRAW PISITGQKPT EGPFSALGYL RVDYQ                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page