(data stored in ACNUC7421 zone)

EMBL: BA000007.SFSA

BA000007.SFSA        Location/Qualifiers
FT   CDS             complement(165105..165809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ECs_0150"
FT                   /product="sugar fermentation stimulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33573"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33573"
FT                   /db_xref="GOA:P0A824"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A824"
FT                   /protein_id="BAB33573.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
     MEFSPPLQRA TLIQRYKRFL ADVITPDGRE LTLHCPNTGA MTGCATPGDT VWYSTSDNTK        60
     RKYPHTWELT QSQSGAFICV NTLWANRLTK EAILNESISE LSGYSSLKSE VKYGAERSRI       120
     DFMLQADSRP DCYIEVKSVT LAENEQGYFP DAVTERGQKH LRELMSVAAE GQRAVIFFAV       180
     LHSAITRFSP ARHIDEKYAQ LLSEAQQRGV EILAYKAEIS AEGMALKKSL PVTL             234
//

If you have problems or comments...

PBIL Back to PBIL home page