(data stored in ACNUC7421 zone)

EMBL: BA000007.TFAE

BA000007.TFAE        Location/Qualifiers
FT   CDS             305423..306016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfaE"
FT                   /locus_tag="ECs_0281"
FT                   /product="phage tail fiber assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33704"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33704"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M0"
FT                   /protein_id="BAB33704.1"
FT                   /translation="MKPVFDENGLATVPGDMRCFYYDAETSEYTGWSDEYINTGVSMPA
FT                   CSTGIDPGENIPGRVAVFTGKGWSHEEDHRNETVYSIENGAAVTVDYIGAIKDGYVTIS
FT                   PLTPYDKWDGEKWVTDTEAQHSAAVDAAEAQRQSLIDAAMASISLIQLKLQAGRKLTQA
FT                   ETTRLNAVLDYIDAVTATDTSTAPDVIWPELPEA"
     MKPVFDENGL ATVPGDMRCF YYDAETSEYT GWSDEYINTG VSMPACSTGI DPGENIPGRV        60
     AVFTGKGWSH EEDHRNETVY SIENGAAVTV DYIGAIKDGY VTISPLTPYD KWDGEKWVTD       120
     TEAQHSAAVD AAEAQRQSLI DAAMASISLI QLKLQAGRKL TQAETTRLNA VLDYIDAVTA       180
     TDTSTAPDVI WPELPEA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page