(data stored in ACNUC7421 zone)

EMBL: BA000007.USPG

BA000007.USPG        Location/Qualifiers
FT   CDS             complement(722794..723222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspG"
FT                   /locus_tag="ECs_0646"
FT                   /product="universal stress protein UP12"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34069"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34069"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBT3"
FT                   /protein_id="BAB34069.1"
FT                   /translation="MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSAS
FT                   LSLHRFAADVRRFEEHLQHEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEEL
FT                   GADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR"
     MYKTIIMPVD VFEMELSDKA VRHAEFLAQD DGVIHLLHVL PGSASLSLHR FAADVRRFEE        60
     HLQHEAEERL QTMVSHFTID PSRIKQHVRF GSVRDEVNEL AEELGADVVV IGSRNPSIST       120
     HLLGSNASSV IRHANLPVLV VR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page