(data stored in ACNUC7421 zone)

EMBL: BA000007.VGRE

BA000007.VGRE        Location/Qualifiers
FT   CDS             264862..267003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrE"
FT                   /locus_tag="ECs_0236"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33659"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33659"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC38"
FT                   /protein_id="BAB33659.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVFFHLNQSLSSLFSLALSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIASILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVLYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQILNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
     MSTGLRFTLE VDGLPPDAFA VVFFHLNQSL SSLFSLALSL VSQQFLSLEF QQILDKMAYL        60
     TIWQGDDVQR RVKGVVTWFE LGENDKNQKL YSMKVCPPLW RTGLRQNFRI FQNEDIASIL       120
     GTILQENGVT EWSPLFSEPH PSREFCVQYG ETDYDFLCRM AAEEGIFFYE EHAQKSTDQS       180
     LVLCDTVLYL PESFEIPWNP NTRTEVSTLC ISQFRYSAQI RPSSVVTKDY TFKRPGWAGR       240
     FDQEGQHQDY QRTQYEVYDY PGRFKGAHGQ NFARWQMDGW RNNAEVARGT SRSPEIWPGR       300
     RIVLTGHPQA NLNREWQVVA SELHGEQPQA VPGRRGSGTT LDNHFAVIPA DRTWRPQPLL       360
     KPLVDGPQSA VVTGPAGEEI FCDEHGRVRV KFNWDRYNPS NQDSSCWIRV AQAWAGTGFG       420
     NLAIPRVGQE VIVDFLNGDP DQPIIMGRTY HQENRTPGSL PGTKTQMTIR SKTYKGSGFN       480
     ELKFDDATGK EQVYIHAQKN MNTEVLNNRT TDVINNHAEK IGNNQAITVT NNQILNIGVN       540
     QIQTVGVNQV ETVGSNQIIK VGSNQVEKVG IIRALTVGVA YQTTVGGIMN TSVALLQSSQ       600
     VGLHKSLMVG MGYSVNVGNN VTFSVGKTMK ENTGQTAVYS AGEHLELCCG KARLVLTKDG       660
     SIFLNGTHIH LEGESDVNGD APVINWNCGA TQPVPDAPVP KDLPPGMPDM RQF              713
//

If you have problems or comments...

PBIL Back to PBIL home page