(data stored in ACNUC7421 zone)

EMBL: BA000007.XSEB

BA000007.XSEB        Location/Qualifiers
FT   CDS             complement(507155..507397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="ECs_0476"
FT                   /product="exonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33899"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33899"
FT                   /db_xref="GOA:P0A8H1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8H1"
FT                   /protein_id="BAB33899.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
     MPKKNEAPAS FEKALSELEQ IVTRLESGDL PLEEALNEFE RGVQLARQGQ AKLQQAEQRV        60
     QILLSDNEDA SLTPFTPDNE                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page