(data stored in ACNUC7421 zone)

EMBL: BA000007.YAAJ

BA000007.YAAJ        Location/Qualifiers
FT   CDS             complement(6546..7976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="ECs_0007"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33430"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33430"
FT                   /db_xref="GOA:Q8XA75"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA75"
FT                   /protein_id="BAB33430.1"
FT                   /translation="MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGK
FT                   SLKNSIHPQPGGLTSFQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMA
FT                   TSFAECSLAQLYKERDVNGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGVQA
FT                   NAVARALSFSFDFPPLVTGIILAVFALLAIIRGLHGVARLMQGFVPLMAIIWVLTSLVI
FT                   CVINIGQLPHVIWSIFESAFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAM
FT                   RVLMGSWGAEFVTLVVILFAFSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIG
FT                   GTLLSLPLMWQLADIIMACMAITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRY
FT                   PDIGRQLSRDAWDDVSQE"
     MPDFFSFINS VLWGSVMIYL LFGAGCWFTF RTGFVQFRYI RQFGKSLKNS IHPQPGGLTS        60
     FQSLCTSLAA RVGSGNLAGV ALAITAGGPG AVFWMWVAAF IGMATSFAEC SLAQLYKERD       120
     VNGQFRGGPA WYMARGLGMR WMGVLFAVFL LIAYGIIFSG VQANAVARAL SFSFDFPPLV       180
     TGIILAVFAL LAIIRGLHGV ARLMQGFVPL MAIIWVLTSL VICVINIGQL PHVIWSIFES       240
     AFGWQEAAGG AAGYTLSQAI TNGFQRSMFS NEAGMGSTPN AAAAAASWPP HPAAQGIVQM       300
     IGIFIDTLVI CTASAMLILL AGNGTTYMPL EGIQLIQKAM RVLMGSWGAE FVTLVVILFA       360
     FSSIVANYIY AENNLFFLRL NNPKAIWCLR ICTFATVIGG TLLSLPLMWQ LADIIMACMA       420
     ITNLTAILLL SPVVHTIASD YLRQRKLGVR PVFDPLRYPD IGRQLSRDAW DDVSQE           476
//

If you have problems or comments...

PBIL Back to PBIL home page